KEGG   Geobacillus sp. C56-T3: GC56T3_3211Help
Entry
GC56T3_3211       CDS       T01245                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00010  Glycolysis / Gluconeogenesis
gct00620  Pyruvate metabolism
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GC56T3_3211
   00620 Pyruvate metabolism
    GC56T3_3211
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GC56T3_3211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ADI28136
LinkDB All DBs
Position
3381746..3383266
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGALVTFKKRYENFIGGKWVPPVDGEYFENITPITGQPYCEVPRSKAADIEL
ALDAAHAAKDAWGRTSPAERARLLNKIADRMEENLEMLAVAETWENGKPIRETLAADIPL
AIDHFRYFASCIRAQEGTISEIDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIKLIEDLLPPGVVNIVNGFGLEAGKPLASNPRVAKVAFTG
ETTTGRLIMQYASQNIVPVTLELGGKSPNIFFADVMDKDDEFLDKALEGFTMFALNQGEV
CTCPSRALIHESIYDAFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNMLEGELAGGYYVKPTIFKGHNKMRIFQEEIFGPVLAVTTFKDHDEAL
SIANETLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHVYPAHAAFGGYKMSGIGRET
HKMMLEHYQQTKNLLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgcacaaccaggccagccaggcgcgcttgtcacatttaaaaagcgctacgaa
aacttcattggcggcaaatgggtgccgccggtcgacggcgagtatttcgaaaatatcacg
ccaatcaccggacagccgtattgcgaagtgccgcgctcaaaagcggcggacatcgaactg
gcgcttgacgccgcccatgcagcaaaagacgcatggggacgcacgtctccagcggagcgc
gcccgtttgctgaacaaaatcgccgatcggatggaagaaaacttggaaatgctggccgtc
gccgaaacgtgggaaaacggcaagccgatccgcgagacgctcgcggctgacattccgctc
gccatcgaccatttccgctatttcgccagctgcatccgcgcgcaagaaggcaccatttcg
gaaatcgatcatgacacggtcgcctatcatttcaaagaaccgctcggcgtcgtcggacaa
atcatcccgtggaacttcccgattttaatggcggcctggaaactcgcgccagcgctcgcg
gccggcaactgcgtcgtgttgaaaccggcggagcaaacgccgacgtcgatcctcgttctc
atcaaactcatcgaagatttgcttccgcctggcgtcgtcaacatcgtcaacggctttggc
ttagaagccggcaagccgctcgcctcgaatccacgcgtggcgaaagtggcgttcaccggt
gaaacgacgaccggacggctcatcatgcagtacgcctcgcaaaacatcgtgccggtcacg
cttgagcttggcggcaagtccccgaacattttcttcgctgatgtgatggacaaagatgac
gagtttctcgataaagccctcgaagggtttacgatgttcgctctaaaccaaggcgaagtg
tgcacatgcccgtcgcgcgccctcatccacgagtcgatttacgatgcctttatggaacgg
gcgcttgaacgcgtcaagcaaatcaagcaaggcaatccgctcgatacggaaacaatgatc
ggcgcccaagcctcgtccgagcaactcgagaaaattttgtcatacatcgacatcggcaaa
caggaaggcgccgaacttttgatcggcggcgaacggaacatgctggaaggggaactcgca
ggcggctattacgtcaagccgacgattttcaaaggacataacaaaatgcgcatcttccaa
gaagaaattttcggcccggtgctcgcggtcacgacgtttaaagatcacgacgaagcgctt
tcgatcgccaatgagacgctgtacggccttggcgccggcgtctggacgcgcgacatcaac
accgcgtaccgcttcggccgcggcatccaagccggccgcgtttggacgaactgctatcac
gtctatccggcccatgcggcatttggcggctacaagatgtccggcatcggccgcgaaacg
cacaaaatgatgcttgagcattaccaacaaacgaaaaacttgctcgtcagctattcgccg
aaaaaacttggcttgttctga

DBGET integrated database retrieval system