KEGG   Geobacillus sp. C56-T3: GC56T3_3258Help
Entry
GC56T3_3258       CDS       T01245                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:gct00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    GC56T3_3258
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gct01011]
    GC56T3_3258
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gct03036]
    GC56T3_3258
Enzymes [BR:gct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     GC56T3_3258
Peptidoglycan biosynthesis and degradation proteins [BR:gct01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   GC56T3_3258
Chromosome and associated proteins [BR:gct03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    GC56T3_3258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 SH3_3 SH3_4 SH3_16
Motif
Other DBs
NCBI-ProteinID: ADI28180
LinkDB All DBs
Position
complement(3430127..3431473)
Genome map
AA seq 448 aa AA seqDB search
MRRGTWLALSFCLLWLAAAAWPVGAKGEKEMEETKRLAVVTADRVNVRQGPGVPYRPLAN
VHRGEVYRLVDMKDGWVKIEWEKNRTGWLAARYVALAKETAVVQENQLRLRQEPSRDGRI
IGHLAQGETVFVIGEEGGWKQVVTEDAIGWAAASYLAPAEARSISQQTGTVAADLLNVRA
EPSLHALRIGRLVRGEEVEIVEKKPGWYKIASPTGLDGWVSSAYVQVKGGQANEKEAEAP
QSADRSLLSIIAPSDSRLYVDSWTRGPVQALAGKTIVLDAGHGGKDGGAQSADGIKEKEL
TLETAKLLKNKLQSYGARVVLTRSSDEYVPLSARVAMARLYQADAFISLHYDSADDQQAS
GITVYYYDRFADYGLAQSFEDPLSRLAALPFRGVAFGDYYVLRENDRPSVLLELGYVSNR
TDAATVTTDGYQEAVTTAIADAVRHYFE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtgggacatggctcgccctgtcgttttgtttgctatggctggctgcggctgct
tggccggtgggggcgaaaggggaaaaggaaatggaggaaacgaagcgtctggctgtggtg
acggcggatcgcgtgaatgtccgccaagggccgggagtgccgtatcgtccattggcgaac
gtccaccggggcgaagtgtaccggttggtggacatgaaagatggttgggtgaaaattgaa
tgggagaaaaatcgaaccgggtggctcgctgcgcggtacgtcgcgttggcaaaagagacg
gccgtcgtgcaagaaaaccaactccgccttcgacaagaaccgagccgagatgggcgaatt
attgggcatttggcgcaaggggaaacggtgtttgtgattggggaagaaggcggctggaaa
caggtcgtgacggaagacgccatcggttgggccgctgcatcgtatttggcgccagctgag
gcccgctctatttcacaacagactggaacggtggccgccgatttgctcaacgtgcgagct
gaaccgtcgcttcacgccctgcggatcggccgccttgtccgtggtgaagaggtcgagatt
gtagaaaagaaaccgggatggtacaaaattgcctccccaacagggcttgatggctgggtt
tcgtccgcgtatgtgcaggtaaagggtggacaagccaatgaaaaggaagcggaagcgccc
cagtcggctgaccgctcgctgctttccatcatcgcgcctagcgactcgcgcctttatgta
gacagctggacgcgcggtcctgttcaggcgctggccggaaaaacgatcgttcttgacgct
ggccacggaggcaaagacggcggggcccaaagtgccgatggcatcaaggaaaaggagttg
acgttggaaaccgccaagcttctgaaaaacaagctgcaatcttacggcgcccgcgtcgtg
ctgacgcgctccagcgatgagtatgtgccgctgtccgcgcgcgtggcgatggcgcgcctg
tatcaagcggatgcgtttatcagcctgcattatgacagcgcagacgaccaacaggcgagc
ggcatcaccgtttattattatgaccgttttgccgattacggcttagcgcaatcattcgaa
gacccgctttcccgattggccgcactgcctttccgcggcgttgcgtttggcgactattac
gtgttgcgggaaaacgacagaccgtctgtattgcttgagctcggctatgtaagcaaccgc
acagatgcggcgacggtgacaacagacggctatcaagaagcagtgacgaccgcgatcgcg
gatgcggttcggcattattttgaataa

DBGET integrated database retrieval system