KEGG   Gluconacetobacter diazotrophicus PA1 5 (Brazil): GDI0277Help
Entry
GDI0277           CDS       T00631                                 

Gene name
puuE
Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
gdi  Gluconacetobacter diazotrophicus PA1 5 (Brazil)
Pathway
gdi00250  Alanine, aspartate and glutamate metabolism
gdi00280  Valine, leucine and isoleucine degradation
gdi00410  beta-Alanine metabolism
gdi00640  Propanoate metabolism
gdi00650  Butanoate metabolism
gdi01100  Metabolic pathways
gdi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GDI0277 (puuE)
   00650 Butanoate metabolism
    GDI0277 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GDI0277 (puuE)
   00280 Valine, leucine and isoleucine degradation
    GDI0277 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GDI0277 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gdi01007]
    GDI0277 (puuE)
Enzymes [BR:gdi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     GDI0277 (puuE)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     GDI0277 (puuE)
Amino acid related enzymes [BR:gdi01007]
 Aminotransferase (transaminase)
  Class III
   GDI0277 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAP54220
RhizoBase: GDI0277
UniProt: A9H2Z6
LinkDB All DBs
Position
complement(286765..288138)
Genome map
AA seq 457 aa AA seqDB search
MTGRHRGRPTRRLPRRRGVAYICRADSRQTRTGTMSSTNSDLQARREAAVPRGVASATAI
HAARAENAELWDVEGRRYIDFAGGIAVLNVGHRHPRVMEAVRRQAELFTHTAFQVAPYES
YIALAERLNGLAPFPGPAKTILFSTGAEATENAVKIARAATGRSGVVAFTGAFHGRSLLA
SALTGKVRPYKAPFGSMPAGVYHVPFPAGEVTVEDSLKALDFLFAADIDPAQVAAIIIEP
VQGEGGFRPTPAALLRALRAVCDTHGIVLIADEVQTGFARTGRLFGIELSGVAPDLVCIA
KSLGGGFPLSGVIGRAALMDAVGPGGLGGTYAGAPIACAAALAVLDVIAEEGLVERANAI
GALIRDRLEGMRGRRGLTPISAPRGPGAMIGFDILEGPDGPVRVGGAAAICARAAERGLI
LLSCGIQGETVRILVPLTAPDSLIEEGLAVIEQALAL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggacgtcaccggggacgaccgacaaggcggctcccgcgtcggcggggcgtggcc
tacatctgtcgggcggattcacgccagacgaggacaggcacgatgtcatccaccaattcc
gatcttcaggcccggcgcgaggccgcggtgccgcgcggcgtcgcatcggccaccgccatc
catgccgcgcgggcggagaatgccgagctgtgggatgtcgaggggcggcgctatatcgac
ttcgccggcggcatcgcggtgctgaatgtcggccatcgccacccccgtgtgatggaggcg
gtgcggcggcaggcggagctgttcacccacaccgcgttccaggtcgcgccgtatgaatcc
tacatcgccctggccgagcggctgaacgggctggcgccgtttcccggcccggcgaagacc
atcctgttttcgaccggggccgaggcgaccgagaacgccgtgaagatcgcccgcgcggcg
accgggcgcagcggcgtcgtggcctttaccggcgccttccacggccggtcgctgctggcg
tcggcgctgaccggcaaggtccggccgtacaaggcgccgttcggcagcatgccggcgggc
gtctatcacgtgccgttcccggccggggaggtcacggtcgaggacagcctgaaggcgctg
gatttcctgttcgcggccgatatcgatccggcgcaggtggccgccatcatcatcgagccg
gtacagggcgagggcggattccgtccgacccccgccgccctgctgcgggcgctgcgcgcg
gtctgcgatacgcacgggatcgtgctgatcgccgacgaggtgcagaccggcttcgcgcgg
accgggcggctgttcggcatcgaactgtcgggcgtggcgccggacctggtctgtatcgcg
aaatcgctgggcggcggctttccgctgtcgggcgtgatcggccgcgccgcgctgatggat
gcggtggggcccggcgggctgggcgggacctatgccggggcgccgatcgcctgcgcggcg
gcgctggcggtcctggacgtcattgccgaagaggggctggtggagcgggcgaacgcgatc
ggcgccctgatccgcgaccggctggaggggatgcgcggccggcgcggcctgacgccgatc
agcgcgccgcgcggaccgggagccatgatcggcttcgacatcctggaggggccggacggg
ccggtgcgcgtcggcggggccgccgcgatctgcgcccgcgccgccgaacgggggctgatc
ctgctgtcatgcggcatccagggcgagacggtgcgcatcctggtgccgctgacggcgccg
gacagcctgatcgaggaagggctggcggtcatcgagcaggcgctggcgctttaa

DBGET integrated database retrieval system