KEGG   Gluconacetobacter diazotrophicus PA1 5 (Brazil): GDI0773Help
Entry
GDI0773           CDS       T00631                                 

Gene name
ahpF
Definition
(GenBank) putative alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gdi  Gluconacetobacter diazotrophicus PA1 5 (Brazil)
Brite
KEGG Orthology (KO) [BR:gdi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GDI0773 (ahpF)
Enzymes [BR:gdi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GDI0773 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA DAO FAD_oxidored Thioredoxin_3 FAD_binding_2 HI0933_like Thi4 Glutaredoxin FAD_binding_3 NAD_binding_8 Lycopene_cycl HD_4 ThiF NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: CAP54716
RhizoBase: GDI0773
UniProt: A9HAN3
LinkDB All DBs
Position
complement(790076..791680)
Genome map
AA seq 534 aa AA seqDB search
MRPGNRPTSLEYGILPMLQDTIKSQLKDHFANLAHPIVLEASLDDSAPARDMAALLHEIA
ALSGKIRVSTDGVASRRPSFVIRREDAAGSVAFAAIPMGHEFTSLVLALLQVGGHAPKLP
DDVTAQIRSLSGTYRFETYVSLSCQNCPDVVQALNAMSVLNPNISNITIDGALYQREVED
KNIMSVPQVYLNGQPFGSGRMGVAEILAKLDADAPKRIAERLKDLAPFDILVVGAGPAGS
AAAVYAARKGLRTGLIAERFGGQVMDTAGIENFISVRETEGPKLAAALEAHVRQYDVEVI
SAQRVRELHAAAQPGALHHVVLESGASLRARTIILATGAHWRHLNVPGEEEYRTRGVAYC
PHCDGPFFKGKPVAVAGGGNSGVEAAIDLAGISSHVTLLERDPALRADRLLQDKLRSLSN
VSIMTNAVITKVEGNGTKMTGLTVQDGSGTARYLDVDGVFVQIGLLPNTDWLRGTIERTA
FGEIIVDGRGMTSIPGIFAAGDATTTPYKQIVIAIGDGAKAALAAFDYLIRLPG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgggcaaccgccccacttcactggaatacggaatcctcccgatgctgcaggat
acgatcaagtcacaactcaaggaccatttcgccaatcttgcacatccgatcgtgctcgaa
gcctcgctcgacgacagcgctccggcccgggacatggcggcattgctgcacgagatcgcc
gcgctttccggcaagattcgcgtctcgacggacggcgtggcgtcgcggcgcccatccttc
gtaattcggcgcgaggacgcagcgggcagcgtggcgttcgccgccattcccatgggacat
gaattcacctcgctggttctggcgctgttgcaggtcgggggtcatgcgccgaaactgccg
gacgacgttacggcccagatcaggtcgctgagcggcacgtatcgtttcgaaacctatgtt
tcgctgtcctgccagaactgcccggatgtcgtgcaggcgctcaatgcgatgagcgtgctg
aacccgaacatcagcaacatcacgatcgacggcgcgctgtaccagcgtgaggtcgaagac
aagaacatcatgtccgtcccccaggtgtacctgaacggacagcccttcgggtccggccgc
atgggtgtcgcggagatcctggcgaagctggatgccgacgcaccgaaacggatcgcggaa
cggctgaaggatcttgccccgttcgacatcctggtcgtgggcgcgggtccggccgggtcg
gcggcggcggtctatgcggcgcgcaaggggctgcgtaccggcctgatcgccgagcggttc
ggcggccaggtgatggacaccgccggcatcgagaatttcatctcggtcagggaaacggag
gggccgaagctggccgccgcgctggaggcgcatgtgcgccaatacgacgtggaggtcatt
tccgcgcaacgggtgcgggagttgcatgccgcagcacagcccggcgccctccaccacgtc
gtgctggagagcggggcgagcctgcgggcgcgcacgatcattcttgcaaccggagcgcac
tggagacatctcaacgtccccggcgaggaggagtatcgcacccgtggggtggcctactgc
ccgcactgtgacggtcctttcttcaagggaaagccggtcgcggtcgccggagggggcaat
agcggcgtcgaagccgcgatcgacctcgccgggatcagttcccacgtgacgctgctggag
cgcgacccggcgctgcgggcggacaggctcctgcaggacaagcttcgcagcctgtccaat
gtcagcatcatgacgaatgccgtgatcactaaggtcgaaggcaacggcacgaagatgacg
ggcctgaccgttcaggacggcagcggaaccgcgcggtatctggacgtcgacggcgtattc
gtccagatcggactgcttcccaataccgattggcttcgcggcacgatcgagcgtacggcg
ttcggcgaaattatcgtcgatggccggggcatgacgtcgattcccggaatcttcgcggcg
ggcgatgcgacgaccacgccgtacaagcagatcgtcatcgcgatcggggacggggccaag
gccgcgctggccgcgttcgactaccttatccgcctgcccggctga

DBGET integrated database retrieval system