KEGG   Gluconacetobacter diazotrophicus PA1 5 (Brazil): GDI2421Help
Entry
GDI2421           CDS       T00631                                 

Gene name
dadB
Definition
(GenBank) putative alanine racemase, catabolic
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gdi  Gluconacetobacter diazotrophicus PA1 5 (Brazil)
Pathway
gdi00473  D-Alanine metabolism
gdi01100  Metabolic pathways
gdi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gdi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GDI2421 (dadB)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GDI2421 (dadB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gdi01011]
    GDI2421 (dadB)
Enzymes [BR:gdi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GDI2421 (dadB)
Peptidoglycan biosynthesis and degradation proteins [BR:gdi01011]
 Precursor biosynthesis
  Racemase
   GDI2421 (dadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CAP56364
RhizoBase: GDI2421
UniProt: A9HMX6
LinkDB All DBs
Position
2507879..2509030
Genome map
AA seq 383 aa AA seqDB search
MPVPPIADTAWPHARAGATLTIDLDAIRANYRTVRNLAAGAECAAVVKADAYGLGAARVA
PALQEEGARTFFVAHLDEGMALRRHVSADARIIVLHGAVPGAEKDCLHDDLIPVLNSVDQ
IQRWRGLAHEAGRALPSILQLDTGMSRFGLSENEIRAIVADPDGLRGIDLRLVISHLACA
DDPDDPASTRQRARLVRMRALLPPAPVSLAASSGVFLGRDFHFDLVRPGAALYGVAPNAA
TPNPMRPVVRLQARILQTRHVSPNDGVGYGLTYRPSAMRRIATIATGYADGFMRSGAARG
CAWLGDMQLPVLGRISMDSMTVDVTDAPETLTRPGTMVDLLGPRRGVDDVARAAGTIGYE
ILTSLGHRYHRAYVAGGSDAFSS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttccccccattgccgataccgcatggccccatgcccgggccggcgcgaccctg
accatcgatcttgatgccatccgggccaattaccgcacggtacggaacctggccgccggc
gcggaatgcgctgcggtggtcaaggccgacgcctatgggctgggggcggcccgggtcgct
ccggcgctgcaggaggaaggagcgcggacattcttcgtcgcgcatctggacgagggcatg
gcgctgcgacgccatgtcagcgccgatgcgcgcatcatcgtcctgcatggcgccgtgccg
ggggccgagaaggactgtctgcatgatgacctgatcccggtcctgaacagtgtcgaccag
atccagcgctggcgcgggttggcccatgaggcgggccgcgcattgccgtcgatcctgcaa
ctggataccgggatgtcgcgcttcgggctgtccgagaacgagatccgcgcgatcgtggcg
gacccggacggcctgcgcgggatcgacctgcgcctggtcatcagccacctggcctgcgcg
gacgacccggacgatccagccagtacccgtcagcgtgcgcgcctggtacgaatgcgcgcc
ctgctgccccccgcgccggtcagcctggccgcctcgtcgggtgtcttcctggggcgggac
tttcatttcgatctggtccgtcccggtgcggcgctgtacggcgtggcccccaacgccgct
accccgaacccgatgcgtccggtcgtacgcctgcaggcacgaatcctgcaaacgcgccat
gtcagcccgaatgacggggtgggttacggcctgacctaccgccccagtgcgatgcggcga
atcgcgacgatcgccacgggctatgccgacggtttcatgcgcagcggtgccgcccggggc
tgcgcctggctgggcgacatgcaactgccggtgctgggccggatttcgatggattcgatg
acggtcgacgtcaccgatgcccccgaaacgctgacccggcccggcaccatggtagacctg
ctggggccgcgccgtggcgtcgacgacgtggcccgggcggccggcaccatcggctacgaa
atcctgacatcgctggggcatcgctatcaccgcgcctatgtcgcgggcggctccgacgct
ttttcctcctga

DBGET integrated database retrieval system