KEGG   Gluconacetobacter diazotrophicus PA1 5 (Brazil): GDI3406Help
Entry
GDI3406           CDS       T00631                                 

Gene name
tufB
Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
gdi  Gluconacetobacter diazotrophicus PA1 5 (Brazil)
Brite
Translation factors [BR:gdi03012]
 Eukaryotic Type
  Elongation factors
   GDI3406 (tufB)
 Prokaryotic Type
   GDI3406 (tufB)
Mitochondrial biogenesis [BR:gdi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GDI3406 (tufB)
Exosome [BR:gdi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GDI3406 (tufB)
  Exosomal proteins of breast cancer cells
   GDI3406 (tufB)
  Exosomal proteins of colorectal cancer cells
   GDI3406 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAP57349
RhizoBase: GDI3406
UniProt: A9H3R7
LinkDB All DBs
Position
complement(3500082..3501272)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKTLAKTGGATFKAYDQIDAAPEERARG
ITISTAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSAYQFPGDDIPIIKGSALVTLE
DGDPEVGENRVRDLMDAVDAYIPQPERPVDRPFLMPIEDVFSISGRGTVVTGRVERGVVN
VGDEIEIVGLRATQKTTVTGVEMFRKLLDRGEAGDNIGALVRGTKREDVERGQVLAKPGS
ITPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MDVELIAPIAMDEGLRFAIREGGRTVGAGVVASITA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaattcgagcggacgaagccgcactgcaatatcggcacgatcggtcac
gtcgatcatggcaagacgtcgctgaccgccgcgatcactaagacgctggcgaagaccggt
ggcgccaccttcaaggcgtacgaccagatcgacgcggcgccggaagagcgcgcccgtggc
atcacgatctcgaccgcccacgtcgagtacgagaccgcgaagcgccactacgcgcacgtc
gactgccccggtcacgccgactacgtgaagaacatgatcacgggtgccgcccagatggac
ggtgcgatcctggtcgtgtccgccgccgacggcccgatgccgcagacccgcgagcacatc
ctgctggcccgccaggtcggcgtcccggccctggtcgtgttcctgaacaaggtcgaccag
gtcgacgatccggaactgctcgagctggtcgagatggaagtgcgcgagctgctgtccgcg
taccagttcccgggcgacgatatccccatcatcaagggttcggccctggtgacgctggaa
gacggtgacccggaagtcggcgagaaccgcgtgcgcgacctgatggatgcggtcgatgcc
tacatcccgcagccggagcgtccggtcgaccgtccgttcctgatgccgatcgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgtgtcgagcgtggcgtggtgaac
gtcggtgacgaaatcgaaatcgtcggcctgcgcgcgacgcagaagacgacggtgacgggc
gtcgaaatgttccgcaagctgctggatcgcggcgaggccggcgacaacatcggcgcgctg
gtgcgtggcacgaagcgtgaggacgtcgagcgcggtcaggtcctggcgaagccgggctcc
atcaccccgcacacgaagttcaaggccgaggcctacatcctgacgaaggaagagggcggc
cgtcacacgccgttcttcaccaactatcgtccgcagttctatttccgcaccaccgacgtc
accggcgtcgtgcacctgccggaaggcacggaaatggtcatgccgggcgataacatcgcc
atggatgtcgagctgatcgctccgatcgccatggacgaaggcctgcgcttcgcgatccgc
gaaggcggccgcaccgtcggcgccggcgtggttgcttcgatcacggcctga

DBGET integrated database retrieval system