KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_1243Help
Entry
Gdia_1243         CDS       T00798                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Gdia_1243
Enzymes [BR:gdj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Gdia_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 DAO HI0933_like Thi4 Glutaredoxin FAD_binding_3 K_oxygenase Lycopene_cycl ThiF NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACI51026
UniProt: B5ZH59
LinkDB All DBs
Position
1381279..1382832
Genome map
AA seq 517 aa AA seqDB search
MLQDTIKSQLKDHFANLAHPIVLEASLDDSAPARDMAALLHEIAALSGKIRVSTNGAASR
RPSFAIRREDAAGGVTFAAIPMGHEFTSLVLALLQVGGHAPKLPDDITAQVGSLSGTYRF
ETYVSLSCQNCPDVVQALNAMSVLNPNISNVTIDGALYQREVEEKNIMSVPQVFLNGQPF
GSGRMGVAEILAKLDADAPKRAAERLKDLAPFDILVVGAGPAGSAAAVYAARKGLRTGLV
AERFGGQVMDTAGIENFISARETEGPKLAAALEAHVRQYDVEVISAQRVRELHAAAQPGA
LHHVVLESGASLRARTIILATGARWRPLNVPGEEEYRTRGVAYCPHCDGPFFKGKPVAVA
GGGNSGVEAAIDLAGISSHVTLLERDPALRADRVLQDKLRSLPNVTVMTNAVITKVEGNG
TKMTGLTVQDGEAARHLDVDGVFVQIGLLPNTDWLRGTVERTAFGEIIVDGRGATSVPGI
FAAGDATTTPYKQIVIAIGDGAKAALAAFDHLIRLPG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggatacgatcaagtcgcaactcaaggaccatttcgccaatcttgcacatccg
atcgtgctcgaagcctcgctcgacgacagcgctccggcccgggacatggcggcattgctg
cacgagatcgcagcactgtccggcaagattcgcgtctcgacgaacggcgcggcctcgcgg
cgcccgtccttcgcgatccggcgcgaggacgcggcgggcggcgtgacgttcgccgccatt
cccatgggacatgaatttacctcgctggtcctggcgttgctgcaggtcggcggtcatgcg
ccgaagttgccggacgacatcacggcccaggtcgggtcactgagcggcacgtatcggttc
gaaacctatgtttcgctctcctgccagaactgcccggacgtcgtacaggcgctcaatgcc
atgagcgtgctgaacccgaacatcagcaacgtcacgatcgacggcgcgctgtaccagcgt
gaggtcgaagaaaagaacatcatgtccgtcccccaggtgttcctgaacggacagcccttc
gggtccggccgcatgggcgtcgcggagatcctggcgaaactggatgccgacgcgccgaag
cgggccgcggaacggctgaaggatcttgctccgttcgacatcctggtcgtgggcgcaggg
ccggccgggtcggcggcggcggtctatgccgcacgcaaggggctgcgcaccggcctggtc
gccgagcggttcggcggccaggtgatggacaccgccggcatcgagaatttcatctcggcc
agggaaacggaggggccgaagctggccgccgcgctggaggcgcatgtgcgccagtacgac
gtggaggtcatttccgcgcaacgggtgcgggaactgcatgccgcagcacagcccggcgcc
cttcatcacgtcgtgctggaaagcggggcgagcctgcgggcgcgcacgatcatccttgca
accggagcacgctggaggccgctcaacgttcccggcgaagaggagtatcgcacccggggg
gtagcctactgcccgcattgtgacggccccttcttcaagggaaagccggtcgcggtcgcc
ggagggggcaatagcggcgtcgaagccgcgatcgatcttgccgggatcagttcccacgtg
acgctgctggagcgcgatccggcgctgcgggcggacagggtcctgcaggacaagcttcgc
agcctgcccaacgtcaccgtgatgacgaatgccgtgatcacgaaggtcgaaggcaacggc
acgaagatgacgggcctgaccgttcaggacggcgaagccgcgcggcatctggacgtcgac
ggcgtgttcgtccagatcgggctgctgcccaataccgattggcttcgcggcacggtcgag
cgtacggcgttcggcgaaatcatcgtcgatggccgcggcgcgacgtcggttcccggcatc
ttcgcggcgggcgatgcgacgacgacgccgtacaagcagatcgtcatcgcgatcggggac
ggggccaaggccgcgctggccgcgttcgaccacctgatccgcctgcccggctga

DBGET integrated database retrieval system