KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_2341Help
Entry
Gdia_2341         CDS       T00798                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00250  Alanine, aspartate and glutamate metabolism
gdj00280  Valine, leucine and isoleucine degradation
gdj00410  beta-Alanine metabolism
gdj00640  Propanoate metabolism
gdj00650  Butanoate metabolism
gdj01100  Metabolic pathways
gdj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Gdia_2341
   00650 Butanoate metabolism
    Gdia_2341
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gdia_2341
   00280 Valine, leucine and isoleucine degradation
    Gdia_2341
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gdia_2341
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gdj01007]
    Gdia_2341
Enzymes [BR:gdj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Gdia_2341
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Gdia_2341
Amino acid related enzymes [BR:gdj01007]
 Aminotransferase (transaminase)
  Class III
   Gdia_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACI52095
UniProt: B5ZF51
LinkDB All DBs
Position
complement(2593672..2594943)
Genome map
AA seq 423 aa AA seqDB search
MSSTNSDLQARREAAVPRGVASATAIHAARAENAELWDVEGRRYIDFAGGIAVLNVGHRH
PRVMEAVRRQAELFTHTAFQVAPYESYIALAERLNGLAPFPGPAKTILFSTGAEATENAV
KIARAATGRSGVVAFTGAFHGRSLLASALTGKVRPYKAPFGSMPAGVYHVPFPAGEVTVE
DSLKALDFLFAADIDPAQVAAIIIEPVQGEGGFRPTPAALLRALRAVCDTHGIVLIADEV
QTGFARTGRLFGIELSGVAPDLVCIAKSLGGGFPLSGVIGRAALMDAVGPGGLGGTYAGA
PIACAAALAVLDVIAEEGLVERANAIGALIRDRLEGMRVRRGLTPISAPRGPGAMIGFDI
LEGPDGPVRAGGAAAICARAAERGLILLSCGIQGETVRILVPLTAPDSLIEEGLAVIEQA
LAL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaccaattccgatcttcaggcccggcgcgaggccgcggtgccgcgcggcgtc
gcatcggccaccgccatccatgccgcgcgggcggagaatgccgagctgtgggatgtcgag
gggcggcgctatatcgacttcgccggcggcatcgcggtgctgaatgtcggccatcgccac
ccccgtgtgatggaggcggtgcggcggcaggcggagctgttcacccacaccgcgttccag
gtcgcgccgtatgaatcctacatcgccctggccgagcggctgaacgggctggcgccgttt
cccggcccggcgaagaccatcctgttttcgaccggggccgaggcgaccgagaacgccgtg
aagatcgcccgcgcggcgaccgggcgcagcggcgtcgtggcctttaccggcgccttccac
ggccggtcgctgctggcgtcggcgctgaccggcaaggtccggccgtacaaggcgccgttc
ggcagcatgccggcgggcgtctatcacgtgccgttcccggccggggaggtcacggtcgag
gacagcctgaaggcgctggatttcctgttcgcggccgatatcgatccggcgcaggtggcc
gccatcatcatcgagccggtacagggcgagggcggattccgtccgacccccgccgccctg
ctgcgggcgctgcgcgcggtctgcgatacgcacgggatcgtgctgatcgccgacgaggtg
cagaccggcttcgcgcggaccgggcggctgttcggcatcgaactgtcgggcgtggcgccg
gacctggtctgtatcgcgaaatcgctgggcggcggctttccgctgtcgggcgtgatcggc
cgcgccgcgctgatggatgcggtggggcccggcgggctgggcgggacctatgccggggcg
ccgatcgcctgcgcggcggcgctggcggtgctggacgtcattgccgaagaggggctggtg
gagcgggcgaacgcgatcggcgccctgatccgcgaccggctggaggggatgcgcgtccgg
cgcggcctgacgccgatcagcgcgccgcgcgggccgggagccatgatcggcttcgacatc
ctggaggggccggacgggccggtgcgcgccggcggggccgccgcgatctgcgcccgcgcc
gccgaacgggggctgatcctgctgtcatgcggcatccagggcgagacggtgcgcatcctg
gtgccgctgacggcgccggacagcctgatcgaggaagggctggcggtcatcgagcaggcg
ctggcgctttaa

DBGET integrated database retrieval system