KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_2964Help
Entry
Gdia_2964         CDS       T00798                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:gdj03012]
    Gdia_2964
   03029 Mitochondrial biogenesis [BR:gdj03029]
    Gdia_2964
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gdj04147]
    Gdia_2964
Translation factors [BR:gdj03012]
 Eukaryotic Type
  Elongation factors
   Gdia_2964
 Prokaryotic Type
   Gdia_2964
Mitochondrial biogenesis [BR:gdj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Gdia_2964
Exosome [BR:gdj04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Gdia_2964
  Exosomal proteins of breast cancer cells
   Gdia_2964
  Exosomal proteins of colorectal cancer cells
   Gdia_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACI52694
UniProt: A9H3R7
LinkDB All DBs
Position
3250838..3252028
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKTLAKTGGATFKAYDQIDAAPEERARG
ITISTAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSAYQFPGDDIPIIKGSALVTLE
DGDPEVGENRVRDLMDAVDAYIPQPERPVDRPFLMPIEDVFSISGRGTVVTGRVERGVVN
VGDEIEIVGLRATQKTTVTGVEMFRKLLDRGEAGDNIGALVRGTKREDVERGQVLAKPGS
ITPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MDVELIAPIAMDEGLRFAIREGGRTVGAGVVASITA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaattcgagcggacgaagccgcactgcaatatcggcacgatcggtcac
gtcgatcatggcaagacgtcgctgaccgccgcgatcaccaagacgctggcgaagaccggt
ggcgccaccttcaaggcgtacgaccagatcgacgcggcgccggaagagcgcgcccgtggc
atcacgatctcgaccgcccacgtcgagtacgagaccgcgaagcgccactacgcgcacgtc
gactgccccggtcacgccgactacgtgaagaacatgatcacgggtgccgcccagatggac
ggtgcgatcctggtcgtgtccgccgccgacggcccgatgccgcagacccgcgagcacatc
ctgctggcccgccaggtcggcgtcccggccctggtcgtgttcctgaacaaggtcgaccag
gtcgacgatccggaactgctcgagctggtcgagatggaagtgcgcgagctgctgtccgcg
taccagttcccgggcgacgatatccccatcatcaagggttcggccctggtgacgctggaa
gacggtgacccggaagtcggcgagaaccgcgtgcgcgacctgatggatgcggtcgatgcc
tacatcccgcagccggagcgtccggtcgaccgtccgttcctgatgccgatcgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgtgtcgagcgtggcgtggtgaac
gtcggtgacgaaatcgaaatcgtcggcctgcgcgcgacgcagaagacgacggtgacgggc
gtcgaaatgttccgcaagctgctggatcgcggcgaggccggcgacaacatcggcgcgctg
gtgcgtggcacgaagcgtgaggacgtcgagcgcggtcaggtcctggcgaagccgggctcc
atcaccccgcacacgaagttcaaggccgaggcctacatcctgacgaaggaagagggcggc
cgtcacacgccgttcttcaccaactatcgtccgcagttctatttccgcaccaccgacgtc
accggcgtcgtgcacctgccggaaggcacggaaatggtcatgccgggcgataacatcgcc
atggatgtcgagctgatcgctccgatcgccatggacgaaggcctgcgcttcgcgatccgc
gaaggcggccgcaccgtcggcgccggcgtggttgcttcgatcacggcctga

DBGET integrated database retrieval system