KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_3167Help
Entry
Gdia_3167         CDS       T00798                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00473  D-Alanine metabolism
gdj00550  Peptidoglycan biosynthesis
gdj01100  Metabolic pathways
gdj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Gdia_3167
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Gdia_3167
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Gdia_3167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gdj01011]
    Gdia_3167
Enzymes [BR:gdj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Gdia_3167
Peptidoglycan biosynthesis and degradation proteins [BR:gdj01011]
 Precursor biosynthesis
  Amino acid ligase
   Gdia_3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 B12-binding ATP-grasp_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACI52897
UniProt: B5ZJU5
LinkDB All DBs
Position
complement(3468567..3469514)
Genome map
AA seq 315 aa AA seqDB search
MTRPRTITVLTGGLSAERTVSLSSGAGISAALREEGFDVRVLDAGPDLGAIVADLTAHRP
DVVFNALHGRFGEDGSIQGVLDWMNIPYTHSGVRASAMAMDKAAARSAFRAAGLPVAQGG
VIAIADFPAADPLPAPYVIKPLNEGSSVGVEIVRPGTNRRAAIADAWTYGPLALVEEFIP
GRELTVGVMGDRALTVTDITPNPDAGHEFYDYAAKYQNGGSRHILPARIHPDAFAQALDL
AVAAHRALGCAGASRTDFRYDDTQCGDGPGRLVILEVNTQPGMTPTSLLPEQAGACGIPY
GALCRWMVEHAACRT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtccgcgcaccatcacggtgctgaccggcggcctgtccgccgagcgcaccgtc
agcctgtccagcggcgccggcatcagcgccgccctgcgcgaggaaggattcgacgtccgc
gtgctggatgccgggccggacctcggcgccatcgtcgcggacctgacggcgcaccggccc
gacgtggtgttcaacgccctgcacggccgcttcggcgaggacgggtcaatccagggcgtg
ctggactggatgaacatcccctacacccattccggcgtccgcgcgtcggccatggcgatg
gacaaggcggcggcccgctcggccttccgcgccgcgggcctgccggtggcgcagggcggg
gtcatcgccatcgccgactttcccgccgccgacccgctgcccgccccctatgtcatcaag
ccgctgaacgaaggatcgtcggtgggtgtcgagatcgtacggccgggcaccaaccgccgc
gccgcgatcgccgacgcatggacctacggccccctggcgctggtcgaggaattcatcccc
gggcgcgaactgacggtgggggtaatgggcgaccgcgccctgaccgtgaccgacatcacc
cccaatcccgatgccgggcatgaattctacgactacgccgccaagtaccagaatggcgga
tcgcggcacatcctgcccgcgcgtatccacccggacgcgttcgcccaggcgctggacctg
gcggtggccgcccaccgcgcgctgggctgcgccggcgcgtcgcgcaccgatttccgttac
gacgacacgcagtgcggcgacgggccggggcgactggtgatcctggaggtcaatacccag
cccggcatgaccccgacctcgctgctgcccgaacaggcgggggcctgcggcatcccctat
ggcgcgctgtgccggtggatggtcgaacacgcggcgtgccggacctag

DBGET integrated database retrieval system