KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_3306Help
Entry
Gdia_3306         CDS       T00798                                 

Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00620  Pyruvate metabolism
gdj00680  Methane metabolism
gdj01100  Metabolic pathways
gdj01120  Microbial metabolism in diverse environments
gdj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gdia_3306
  09102 Energy metabolism
   00680 Methane metabolism
    Gdia_3306
Enzymes [BR:gdj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Gdia_3306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ACI53033
UniProt: B5ZL91
LinkDB All DBs
Position
complement(3613615..3616428)
Genome map
AA seq 937 aa AA seqDB search
MTDTPTRDAAEMLLDLTRQAVADHENSSSGNPIIALARRIGRQLTAGTLTTDTLEQVVRQ
LRDTAFRDRAARLHAYVGGTDDAAIAGRMRGVAQTVASEPGPDGTPPNFGHFRKNLERSR
FAAVFTAHPTFALANPVYDVLATLASSDDGRTGTVPALATHRRPAPPTLEEEFALASAAI
VRGRNALDRLTGILLAEARTRWPHEWSVLSPRPVILTTWVGYDTDGRTDIGWWDTIRLRL
RMKRLQLERLRDQITPLRPVADGLHERVARALDAVTDQIEACPVGAAPGPDSVAAFAAVL
IGRREDAIMGASELASSFQEAIDTAPPDDRMALAIARAGLMAHGMAAAHTHVRLNSTQIH
NVARQRLGIDDSPEIPSQRRALLSRINEALDHVQPVNIDFGSLLVEQATAARLMMTVRQI
VRHIDRESPVRFLIAETESGYTLLAALWLARTFGIEEHVEISPLFETQEALENGAHIVEE
ALHSPHWREYLRRTGKLSLQFGYSDSGRYVGQLAATYLIERLRLKICELLRRWNLTDVEV
ILFDTHGESIGRGAHPFRLSDRLDYLSPLHARAVFADAGLRIREETAFQGGDGYLLFGTQ
ALADATISIIASHVFAHTVVDRDPVYDQPDFSADFFSTIGAGMAGLVEDPGYAALLGAFG
PSLIDKTGSRPSARQSDSGAAASRITHPSQLRAIPNNAILQQLGWCANTIQGLGTAAARH
PETFEEFLSRSPRFRRALDFASHALAHSDDTVLRAVVYMLDPDMWLDRATAESDPARRDA
YLALMHGLERLNFWASTQAMFRRIQSDHLALRRAWQQAPAMGAEEKLLHAIRIATIERIW
LLSTRIPYFSPRNAFSRDELTTRVLCLEIPAALRELDYIFPSVTGGGLDLDYHEDHGPRN
EGAYIREHAEIFEPMLHLFNLVRETGTAIMHHVGAFG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacccccacccgcgatgcggcagagatgctgctcgaccttacgcggcaagct
gtcgcggatcacgagaactcgtcatcgggcaatcccatcatcgccctggcgcgccgaatc
ggccgccagctgacggccggcaccctgaccaccgacacgctggaacaggtggtgcgccag
ttgcgcgacacggcgttccgcgaccgggcggcgcggctgcatgcctatgtcgggggcacg
gatgacgccgccatcgccgggcggatgcgcggcgtggcgcagaccgtcgccagcgaaccc
ggaccggacggcaccccgccgaatttcgggcatttccgcaagaacctggaacgcagccgc
ttcgcggccgtgttcaccgcccatccgaccttcgccctggccaaccccgtctatgacgtg
ctggcgacgctggcatcgtccgatgacgggcgtaccggcacggtgccggccctggccacc
caccgccgccccgccccgccgacgctggaggaagaattcgccctggcctcggccgcgatc
gtgcgcgggcgcaacgcgctggaccggctgaccggaatcctgctggccgaggcccgcacc
cgctggccccacgaatggtcggtgctgagcccccgacccgtgatcctgaccacctgggtc
gggtacgacacggacgggcggaccgatatcggctggtgggacacgatccgcctgcggctg
cgcatgaagcgcctgcagcttgaacggctgcgcgaccagatcaccccgctgcgcccggtg
gccgacgggctgcatgaacgcgtggcccgcgcgctggacgcggtcacggaccagatcgag
gcctgccccgtgggcgcggcgcccggccccgattccgtcgccgcattcgccgccgtgctg
atcggccggcgcgaggacgcgatcatgggcgccagcgaactggcgtcctcgttccaggaa
gccatcgacaccgcgccgccggacgaccggatggccctggccatcgcccgggccggcctg
atggcccacggcatggccgcagcccacacccatgtccggctgaattcgacgcagatccac
aacgtcgcgcgccagcgcctgggcatcgacgacagtcccgagatcccgtcgcagcgccgc
gcgctgctcagccgcatcaacgaggcactggaccacgtccagccggtcaacatcgatttc
ggatcgctgctggtcgaacaggcgacggccgcgcgcctgatgatgacggtgcgccagatc
gtgcgccacatcgaccgcgagagcccggtccgtttcctgatcgccgagaccgagagcggc
tatacgctgctggccgccctgtggctggcccggaccttcggcatcgaggaacatgtcgag
atctcgccgctgttcgagacgcaggaggcgctggagaacggcgcccatatcgtcgaggaa
gcgctgcattccccgcactggcgcgagtatctgcgccgcaccggcaagctgagcctgcaa
ttcggctattccgattccggccgctatgtcgggcagctggccgcgacctacctgatcgag
cggctgcggctgaagatctgcgaattgctgcggcgctggaacctgacggatgtcgaggtc
atcctgttcgacacccatggcgagagcatcgggcgcggcgcgcatccgttccgcctgtcc
gaccggctggattacctgtcgccgctgcacgcccgcgccgtcttcgccgatgccggcctg
cgcatccgcgaggaaacggccttccagggcggtgacggctatctgctgttcggcacccag
gcgctggccgacgcgaccatcagcatcatcgcgtcgcatgtcttcgcgcataccgtggtc
gatcgcgacccggtctatgaccagcccgatttttcggccgatttcttctcgaccatcggg
gccggcatggccggactggtcgaagatccgggctatgccgcgctgctgggcgccttcggc
ccgtcgctgatcgacaagacggggtcccgcccatcggcccggcagagcgattccggcgcc
gccgccagccgcatcacccaccccagccagctccgcgccattcccaacaacgccatcctg
cagcaactgggctggtgcgcgaacaccatccaggggctgggcacggccgccgcccgccac
cccgagacgttcgaggaattcctcagccgcagcccgcgcttccgccgggcgctggatttc
gcatcgcatgcgctggcgcattccgacgatacggtactgcgcgccgtggtctacatgctg
gaccccgacatgtggctggaccgcgccaccgccgagtccgaccccgcgcggcgcgatgcc
tacctggcgctgatgcacgggctggagcggctgaatttctgggccagcacccaggccatg
ttccgccgcatccagtcggaccacctggcgctgcgccgcgcctggcaacaggcccccgcc
atgggggccgaggaaaagctgctgcacgcgatccgcatcgccaccatcgagcggatctgg
ctgctatccacccgcattccctacttttcgccgcgcaacgccttttcgcgcgacgaactg
acgacgcgggtgctgtgcctggaaattcccgccgcgctgcgggagctggactatatcttc
ccctcggtcaccggcggcggactggacctggattatcacgaggaccacggcccacggaac
gaaggggcctatatccgcgagcacgccgagattttcgagccgatgctgcacctgttcaat
ctggtccgtgaaaccggcacggcgatcatgcaccatgtcggggccttcggctga

DBGET integrated database retrieval system