KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_3373Help
Entry
Gdia_3373         CDS       T00798                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00970  Aminoacyl-tRNA biosynthesis
gdj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Gdia_3373
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gdj03029]
    Gdia_3373
Enzymes [BR:gdj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Gdia_3373
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Gdia_3373
Mitochondrial biogenesis [BR:gdj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Gdia_3373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ACI53099
UniProt: B5ZLF7
LinkDB All DBs
Position
3694895..3696343
Genome map
AA seq 482 aa AA seqDB search
MTYLVEGRTGPWELVVGLEVHAQVISRSKLFSGASASYGGEPNTHVSLVDAGFPGMLPVI
NRECVAQAVRTGLGLKARINLESRFDRKNYFYADLPTGYQISQFAHPIIGEGAVEIELAD
GATRTIGITRLHLEQDAGKSMHDQDPTRSFIDLNRAGVALMEIVSEPDIRTPEEAGAYLR
KLRMILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRYVMQAIEVEAV
RQVEIWESGGEVDQETRLFDPARGETRSLRSKEDAHDYRYFPDPDLLPLVIEEAWVESLA
AVLPELPDAKRQRFQDEYGIPRYDAGVLVAEQATADFYETVARGRDPRLAANWVIGDLFA
ALNRTGRTIQDSPISADALGGMLDLVTDGTINGKIAKEVFEDMLETGDPAAAIVERKGLR
QVTDTGAIDAAVQAVLAANADKLAEYRSGKDKLFGFFVGQVMKAMAGKGNPALVNEALKK
VL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgacctatctggtcgaaggccgtaccggcccctgggaactggtcgtggggctggaagtc
cacgcccaggtcatcagccggtccaagctgttctcgggcgcctcggcctcgtacgggggc
gagccgaacacccatgtcagcctggtcgatgccggtttccccggcatgctgccggtcatc
aaccgcgaatgcgtggcccaggcggtgcggaccggcctggggctgaaggcgcggatcaac
ctggaaagccggttcgaccgcaagaactatttctatgcggacctgccgacgggctaccag
atcagccagttcgcccacccgatcatcggcgagggcgcggtggaaatcgaactggccgac
ggcgcgacccgcaccatcgggatcacgcgcctgcatctggaacaggatgccggcaagtcg
atgcatgaccaggacccgacgcggtccttcatcgacctgaaccgcgcgggcgtcgcgctg
atggaaatcgtcagcgaacccgatatccgcacgcccgaggaagccggggcctatctgcgc
aagttgcgcatgatcctgcgctacctgggcacctgcgacggcaacatggaagagggttcg
atgcgcgccgacgtgaacgtgtcggtccgcaaggcgggcgagccgttccgcacccggtgc
gagatcaagaacgtcaattcgatccgctacgtgatgcaggcgatcgaggtcgaggccgtc
cgccaggtggaaatctgggaaagcggcggcgaggtcgatcaggagacccgcctgttcgac
cccgcccggggcgagacacgctcgctgcgcagcaaggaagacgcccacgactaccgctat
ttccccgatcccgacctgctgccgctggtgatcgaggaagcatgggtcgaatcgctggcc
gccgtcctgccggaactgccggatgccaagcgccagcgcttccaggacgagtacggcatc
ccgcgctacgatgccggggtgctggtggccgaacaggcgaccgccgatttctacgaaact
gtcgcgcgcgggcgggacccgcgcctggcggccaactgggtgatcggcgacctgttcgcg
gcactgaaccgcaccggccgcacgatccaggacagcccgatcagcgccgacgcgctgggc
ggtatgctggacctggtcacggacggcacgatcaacggcaagattgccaaggaagtgttc
gaggatatgctggagaccggcgaccccgccgccgcgatcgtcgagcgcaagggattgcgg
caggtcaccgataccggggcgatcgacgccgccgtgcaggccgtactggcggcgaacgcg
gacaagctggccgaataccgttcgggcaaggacaagctgttcggattcttcgtcggtcag
gtcatgaaggcgatggccggcaagggcaatccagccctggtgaacgaggccctgaagaaa
gttctgtaa

DBGET integrated database retrieval system