KEGG   Geobacillus sp. 12AMOR1: GARCT_00131Help
Entry
GARCT_00131       CDS       T03966                                 

Gene name
tuf
Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
gea  Geobacillus sp. 12AMOR1
Brite
KEGG Orthology (KO) [BR:gea00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:gea03012]
    GARCT_00131 (tuf)
   03029 Mitochondrial biogenesis [BR:gea03029]
    GARCT_00131 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gea04147]
    GARCT_00131 (tuf)
Translation factors [BR:gea03012]
 Eukaryotic Type
  Elongation factors
   GARCT_00131 (tuf)
 Prokaryotic Type
   GARCT_00131 (tuf)
Mitochondrial biogenesis [BR:gea03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GARCT_00131 (tuf)
Exosome [BR:gea04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GARCT_00131 (tuf)
  Exosomal proteins of breast cancer cells
   GARCT_00131 (tuf)
  Exosomal proteins of colorectal cancer cells
   GARCT_00131 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AKM17490
UniProt: A0A0G3XSZ5
LinkDB All DBs
Position
127543..128730
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAKAYDQIDAAPEERERG
ITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDPQWEEKIIELMNAVDEYIPTPQREVDKPFMMPIEDVFSITGRGTVATGRVERGTLKVG
DPVEIIGLSDEPKATTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVERGQVLAKPGSI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaatttgagcgcacgaaaccgcacgtcaacattggcacgatcggccac
gttgaccatgggaaaacgacgttgacagctgcgatcacgacggttttggcgaaacaaggg
aaagccgaagcaaaagcgtacgaccaaatcgacgcagctccggaagagcgtgaacgcgga
atcacgatttcgacagcgcacgtcgagtatgaaacagatgctcgtcactatgcgcacgtt
gactgcccgggccacgctgactacgtcaaaaacatgatcacgggcgcagcgcaaatggac
ggcgcgatccttgttgtatcggctgctgacggtccgatgccgcaaacgcgcgaacacatt
cttctctcccgccaagtcggtgtaccgtacatcgttgttttcttgaacaaatgcgacatg
gtggacgatgaagaattgcttgaactcgttgaaatggaagttcgcgatcttctctctgaa
tacgacttcccgggcgacgaagtgccggtcatcaaaggttcggcattaaaagcactcgaa
ggcgatccgcaatgggaagaaaaaatcattgaattgatgaacgcggttgatgagtacatc
ccgactccgcaacgtgaagttgacaaaccgttcatgatgccgattgaggacgttttctcg
atcacaggccgtggtacggttgcgacgggccgtgttgagcgcggtacgctcaaagtcggt
gacccggttgaaatcatcggtctttctgacgagccgaaagccacgacggttacgggtgtt
gaaatgttccgtaaacttcttgaccaagcagaagctggagacaacatcggtgcgcttctc
cgcggtgtatcgcgcgacgaagttgagcgcggccaagtattggcaaaaccgggctcaatc
acgccgcatacgaaatttaaagcacaagtttacgttctgacgaaagaggaaggcggacgc
catactccgttcttctcgaactatcgtccgcaattctacttccgcacaacggacgtaaca
ggcatcatcacgcttccggaaggcgttgaaatggttatgcctggcgacaacgttgagatg
acggttgagctgatcgcgccgatcgcgatcgaggaaggaacgaaattctcgatccgtgaa
ggcggccgtacagttggcgctggttccgtatcggaaatcatcgagtaa

DBGET integrated database retrieval system