KEGG   Geobacillus sp. 12AMOR1: GARCT_00261Help
Entry
GARCT_00261       CDS       T03966                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00473  D-Alanine metabolism
gea01100  Metabolic pathways
gea01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GARCT_00261 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GARCT_00261 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gea01011]
    GARCT_00261 (alr)
Enzymes [BR:gea01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GARCT_00261 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:gea01011]
 Precursor biosynthesis
  Racemase
   GARCT_00261 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKM17609
UniProt: A0A0G3XVN3
LinkDB All DBs
Position
250236..251453
Genome map
AA seq 405 aa AA seqDB search
MISSAFKFAQQERQRETMNDFHRDTWAEVDLDAIYDNVANLRRLLPDDTHIMAVVKANAY
GHGDVQVARTALEAGASRLAVAFLDEALALREKGIEAPILVLGASRPADAALAAQQRIAL
TVFRSDWLEEASALYSGPIPIHFHLKMDTGMGRLGVKDEEETKRIAALIERHPHFVLEGV
YTHFATADEVNTDYFSYQYTRFLHMLEWLPSRPPLVHCANSAASLRFPDRTFNMVRFGIA
MYGLAPSPGIKPLLPYPLKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIG
YADGWLRRLQHFHVLVDGQKAPIVGRICMDQCMIRLPGPLPVGTKVTLIGRQGDEVISID
DVARHLETINYEVPCTISYRVPRIFFRHKRIMEVRNAIGRGESSA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgagcgctttcaagtttgcgcaacaggaaaggcagcgagaaaccatgaacgac
tttcatcgcgatacgtgggcggaagtggatttggacgccatttacgacaatgtggcgaat
ttgcgccgtttgctgccggacgacacgcacattatggcggtcgtgaaggcgaacgcctat
ggacatggggatgtgcaggtggcaaggacagcgctcgaagcgggggcctcccgcctggcg
gttgcctttttggatgaggcgctcgctttaagggaaaaaggaatcgaagcgccgattcta
gttctcggggcttcccgtccagctgatgcggcgctggccgcccagcagcgcattgccctg
accgtgttccgctccgactggttggaagaagcgtccgccctttacagcggccctattcct
attcatttccatttgaaaatggacaccggcatgggacggcttggagtgaaagacgaggag
gagacgaaacgaatcgcagcgctgattgagcgccatccgcattttgtgcttgaaggggtg
tacacgcattttgcgactgcggatgaagtgaacaccgattatttttcctatcagtatacc
cgttttttgcacatgctcgaatggctgccgtcgcgcccgccgctcgtccattgcgccaac
agcgcagcgtcgctccgtttccctgaccggacgttcaatatggtccgcttcggcattgcc
atgtatgggcttgccccgtcgcccggcatcaagccgctgctgccgtatccattaaaagaa
gcattttcgctccatagccgcctcgtacacgtcaaaaaactgcaaccaggcgaaaaggtg
agctatggtgcgacgtacactgcgcagacggaggagtggatcgggacgattccgatcggc
tatgcggacggctggctccgccgcctgcagcactttcatgtcctcgttgacggacaaaag
gcgccgattgtcggccgcatttgcatggaccaatgcatgatccgcctgcctgggccgctg
ccggtcggcacgaaggtgacactgattggccgccaaggggacgaggtgatttccattgat
gatgtcgctcgccatttggaaacgatcaactacgaagtgccttgcacgatcagttatcga
gtgccccgtatttttttccgccataagcgtataatggaagtgagaaacgccattggccgc
ggggaaagcagtgcataa

DBGET integrated database retrieval system