KEGG   Geobacillus sp. 12AMOR1: GARCT_00347Help
Entry
GARCT_00347       CDS       T03966                                 

Gene name
gatA_1
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00970  Aminoacyl-tRNA biosynthesis
gea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gea00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GARCT_00347 (gatA_1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gea03029]
    GARCT_00347 (gatA_1)
Enzymes [BR:gea01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GARCT_00347 (gatA_1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GARCT_00347 (gatA_1)
Mitochondrial biogenesis [BR:gea03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GARCT_00347 (gatA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKM17678
UniProt: A0A0G3XV81
LinkDB All DBs
Position
333921..335378
Genome map
AA seq 485 aa AA seqDB search
MSLFDHSVSELHTLLQKKEVSISDLVDESYRRIGEVEEKVQAFLTLNEEQARAKAKELDD
QLAKGEETNPLFGLPIGIKDNIVTKGLRTTCASKILYNFDPIYDATVMERLNAAGAITIG
KLNMDEFAMGSSTENSGFQLTRNPWDLERVPGGSSGGSAAAVAAGEVPFALGSDTGGSIR
QPAAFCGVVGLKPTYGRVSRFGLVAFASSLDQIGPITRTVEDNAYLLQAIAGVDPMDSTS
ASVPVPNYVEALTGDIKGLKIAVPNEYLGEGVDESVRQSVLAALAVLEKLGATWEEVSLP
HSKYALATYYLLASSEASANLARFDGVRYGYRTDNAKNLIDMYKLTRSEGFGAEVKRRIM
LGTFALSSGYYDAYYKKAQKVRTLIKRDFENVFEQYDVIIGPTTPTPAFKIGEKTSDPLT
MYANDILTIPVNLAGVPAISVPCGFVDGLPVGLQIIGKHFDESTVYRVAHAFEQATDYHK
QKPVL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctttttgaccattccgtatcagaattacatacgttgctgcagaaaaaagaagtg
tcgatttccgatttagtcgacgaatcgtaccgacgcatcggcgaagtggaagaaaaagtg
caagcgtttttaacattaaatgaagaacaggcgcgggcgaaagcgaaagagttggatgac
cagctcgccaaaggcgaagaaacgaacccgctgttcggcttgccgatcggcattaaagac
aacatcgtcacaaaaggattgcgcacgacatgcgccagcaaaattttgtacaactttgac
cccatctatgacgcgactgttatggagcggctgaacgctgcgggcgccattacgatcggg
aagctgaacatggatgagttcgccatgggctcgtcgacggaaaactccggctttcagctg
acgcgcaacccgtgggacttagagcgcgttccgggcggctcgagcggcggttcggcggcg
gcggtggcggcaggggaagtgccgtttgctttaggttctgatacgggcggttcgatccgc
cagccggcggcgttttgcggggtcgtcgggttgaaaccgacgtacggccgcgtctcgcgc
tttggcctcgtcgcgtttgcctcgtcgcttgaccaaatcggcccgattacgcgcacggtc
gaagacaacgcctacttattgcaggcgattgcaggcgtcgacccgatggattcgacatcg
gcaagcgtgccggtgccgaactatgtggaggcgttgaccggggacatcaaaggattgaaa
atcgccgtgccgaacgaatatttaggcgaaggcgtcgatgaaagcgtgcgccagtcggtg
ctggcggcgcttgccgtgcttgagaagcttggcgcaacatgggaagaagtgtcgctgccg
cattcgaaatatgcgctcgcgacgtactacttgctcgcttcatcggaagcttcggcgaac
ctcgctcgctttgacggcgtccgctacggctatcggacggacaacgccaaaaacttgatc
gatatgtataaactcacacggagcgaaggattcggggcggaggtcaagcgccgcattatg
ctcgggacgttcgcgttaagctcgggctattacgatgcgtattacaaaaaagcgcaaaaa
gtgcggacgttgatcaaacgagattttgagaacgtctttgaacagtatgacgtcatcatc
ggcccgacaacgccgacgccggcgtttaaaatcggcgagaaaacgagcgatccgctgacg
atgtacgcaaacgacattttaacgatcccggtcaacctggcaggcgtgccggccatttcc
gtgccgtgcggctttgtcgacggcttgccggtcggcttgcaaatcatcggcaagcacttt
gatgaaagcacggtctaccgcgtcgcccacgcttttgaacaggcgaccgactaccataag
caaaaaccggtgttgtaa

DBGET integrated database retrieval system