KEGG   Geobacillus sp. 12AMOR1: GARCT_00683Help
Entry
GARCT_00683       CDS       T03966                                 

Definition
(GenBank) Beta/alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00500  Starch and sucrose metabolism
gea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gea00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GARCT_00683
Enzymes [BR:gea01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GARCT_00683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase GHL10 Malt_amylase_C Glyco_hydro_66 Cellulase GHL6 NifT
Motif
Other DBs
NCBI-ProteinID: AKM17985
UniProt: A0A0G3XUB1
LinkDB All DBs
Position
663014..664549
Genome map
AA seq 511 aa AA seqDB search
MGNRLFMLLVLPFLLFYAWPVQAAEKEERTWQDEAIYFIMVDRFNNMDPTNDKGVNVNDP
KGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFENMPGGYHGYWIKDFYRVDPHFGTLDDL
KTLVKEAHQRDMKVILDFVANHVGYDHPWLRDPAKKDWFHPKKEIFDWNDQTQLENGWVY
GLPDLAQENPEVKKYLIDAAKWWIKETDIDGYRLDTVRHVPKSFWQEFAKEVKSVKQDFF
LLGEVWSDDPRYIAEYGQYGIDGFVDYPLYGAVKQSLARRDASLRPLYDAWEYNKTFYDR
PYLLGTFLDNHDNVRFTKLSIDNRNNPISRIKLAMTYLFTAPGIPIMYYGTEIAMNGGQD
PDNRRLMDFRADPEIIDYLKKIGPLRQQLPSLRRGDFTLLYEKDGMAVWKRQYEDETTVI
AINNTGETQHVHLTNDQLPKNKELRGFLLDDLVRGDGDGYDLVLDRETAEVYKLREKTGI
NVPFIAAIVSVYVLFLLFLYLVKKRAKRMPE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccggctctttatgctgctcgtccttccgttccttcttttttatgcctggccg
gtgcaggcggcggagaaagaagaacggacgtggcaagatgaagcgatttatttcattatg
gtcgaccggtttaacaatatggatccgacgaatgacaagggcgtcaatgtcaacgatccg
aaagggtatttcggcggcgacttgaaaggggtgacggcgaaacttgattacatcaaggag
atgggatttacggccatttggctgacgccgattttcgaaaacatgccgggcggataccac
gggtattggatcaaagatttttatcgcgtcgacccgcattttggcacgctcgatgacttg
aaaacgctagtcaaagaggcgcatcagcgcgatatgaaagtcattttggattttgttgcc
aatcatgtcggctacgaccatccatggcttcgcgacccggcgaaaaaagattggttccat
ccgaaaaaagagattttcgactggaatgatcaaacacaactagaaaacggatgggtgtat
gggctgccggatttagcgcaggaaaatccagaagtcaagaaatatttaatcgatgcggcc
aaatggtggatcaaagaaacggacattgacggctatcgcctcgatacggtgcgccatgtg
ccaaaatcattttggcaggagttcgccaaagaagtgaaatcggtgaaacaagactttttc
cttcttggcgaagtgtggagcgacgatccgcgctatattgccgagtacggccaatacggc
atcgacggttttgtcgattatccgctgtatggcgcggtgaagcagtcgcttgctaggcgc
gatgcatcgctccggccgttgtatgacgcctgggaatacaacaaaacgttttacgaccgc
ccgtacttgctcgggacgtttttggacaatcacgataacgtgcggtttacgaaactttcg
attgacaaccgcaacaatccgatttcacgcatcaagctggcgatgacgtatttgttcacc
gcccccggcatcccgatcatgtattacggaaccgaaatcgccatgaacggcggccaagat
ccggacaaccgccgcttgatggatttccgcgccgatccggagatcatcgattacttgaaa
aaaatcggcccgctccgccaacagctgccgtctttgcggcgcggcgattttacgctcctg
tatgaaaaagacggcatggcggtgtggaaacggcaatatgaagatgaaacaacggttatc
gccatcaacaacacgggcgaaacgcagcacgttcacctaacgaacgaccagttgccaaaa
aacaaggaactgcgcggctttttattggacgatctcgtccgcggcgatggcgacggatac
gatcttgtgctcgaccgcgaaacggcggaagtgtacaagctgcgggaaaaaactgggatc
aacgttccgtttatcgccgccatcgtatcggtttacgtattgtttcttttgtttttgtat
ttggtgaaaaaacgggcgaagcggatgccggaatag

DBGET integrated database retrieval system