KEGG   Geobacillus sp. 12AMOR1: GARCT_00705Help
Entry
GARCT_00705       CDS       T03966                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00010  Glycolysis / Gluconeogenesis
gea00071  Fatty acid degradation
gea00350  Tyrosine metabolism
gea00625  Chloroalkane and chloroalkene degradation
gea00626  Naphthalene degradation
gea01100  Metabolic pathways
gea01110  Biosynthesis of secondary metabolites
gea01120  Microbial metabolism in diverse environments
gea01130  Biosynthesis of antibiotics
gea01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GARCT_00705
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GARCT_00705
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    GARCT_00705
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GARCT_00705
   00626 Naphthalene degradation
    GARCT_00705
Enzymes [BR:gea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GARCT_00705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_11 Methyltransf_25 3HCDH_N PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKM18006
UniProt: A0A0G3XWL3
LinkDB All DBs
Position
complement(684155..685174)
Genome map
AA seq 339 aa AA seqDB search
MKAAVVEQFKEPLKIKEVEKPTISYGEVLVRIKACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVEEVGPGVTHLKVGDRVGIPWLYSACGHCEYCLSGQETLCEQQKNAGYSVDGGY
AEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTGAKPGEWVAIYGIGGLGHVA
VQYAKAMGLNVVAVDIGDEKLELAKELGADLVVNPLKEDAAKFMKEKVGGVHAAVVTAVS
KPAFQSAYNSIRRGGACVLVGLPPEEMPIPIFDTVLNGIKIIGSIVGTRKDLQEALQFAA
EGKVKTIIEVQPLEKINEVFDRMLKGQINGRVVLTLEDK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtagtggaacaatttaaggaaccattaaaaataaaagaagtagaaaaa
ccaaccatttcatatggagaagtattagtccgcattaaagcatgcggtgtttgtcatact
gacttgcatgccgctcacggcgattggccggtaaaaccaaaacttcctttaatccctggc
catgaaggagtaggaattgttgaagaagtaggtccaggcgtaacccatttaaaagtgggc
gaccgcgttggaattccttggttatattccgcttgcggccattgtgaatattgtttaagc
ggacaagagacattatgtgagcaacaaaaaaatgcaggctactcagtcgacggaggttat
gctgaatactgcagagcggcggcagactatgtggttaaaattcctgacaacttatcattt
gaagaagctgccccaattttctgcgccggagttactacctataaagcgttaaaagtaaca
ggggcaaaaccaggagaatgggtagcaatttacggtatcggcggccttggacacgttgcc
gttcaatacgcgaaggcgatgggacttaatgtcgttgctgttgatatcggcgacgaaaaa
cttgaacttgcaaaagaacttggcgctgatcttgttgtaaaccctttgaaagaagatgca
gcgaaatttatgaaagagaaagtcggcggagttcacgcagcagtcgtaacagctgtatct
aagccagcgtttcaatctgcgtacaattctatccgcagaggcggagcttgtgtgcttgtc
ggattgccaccggaagaaatgcctattccaatttttgatacggttttaaatggaatcaaa
atcatcggttccattgtcggcacgcggaaagacctgcaagaagcgctccaattcgcagcg
gaaggtaaagtaaaaaccattattgaagtgcaacctcttgaaaaaattaatgaagtattt
gacagaatgctaaaaggtcaaattaacgggcgtgtagttttaacgttagaagataaataa

DBGET integrated database retrieval system