KEGG   Geobacillus sp. 12AMOR1: GARCT_00964Help
Entry
GARCT_00964       CDS       T03966                                 

Gene name
dapL_2
Definition
(GenBank) LL-diaminopimelate aminotransferase
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00270  Cysteine and methionine metabolism
gea01100  Metabolic pathways
Module
gea_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GARCT_00964 (dapL_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gea01007]
    GARCT_00964 (dapL_2)
Enzymes [BR:gea01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     GARCT_00964 (dapL_2)
Amino acid related enzymes [BR:gea01007]
 Aminotransferase (transaminase)
  Class I
   GARCT_00964 (dapL_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKM18259
UniProt: A0A0G3XXK9
LinkDB All DBs
Position
950723..951898
Genome map
AA seq 391 aa AA seqDB search
MTIEFPFSELLEQLPKQFFASLVAKVGAKIKAGYDVINLGQGNPDQPTPAHIVEAMQKAA
ANPKYHKYSPFQGYSFLKEAVAAFYAREYGVTIDPAREVAILFGGKAGLVELPLCLVNPG
DVVLVPDPGYPDYWSGIALARARMEMMPLVAENGFLPDYSAIPRAAADRAKLMFLNYPNN
PTGATATKEFFAETVAFAEKYGIAVVHDFAYGAIGFDGQKPVSFLEVDGAKDIGVEIYTF
SKTYNMAGWRVAFAVGNERIIRAIELLQDHLYVSLFGAVQEAAAAALLGPQDCVAELVAL
YEARRNTFIHALRAIGWEAPAPSGSFFAWLPLPKGASSAEFADLLLERAHVAVAPGIGFG
KHGEGYVRVGLLTDEARLREAAERIGRLGLF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgaatttcccttttccgaactgcttgaacagctgccgaagcagtttttcgcc
tcgctcgtggcgaaagtcggtgcgaagatcaaggcgggttatgatgtgatcaacttaggg
cagggcaatccggatcagccgacgccggcgcacattgtcgaagcgatgcagaaggcagcc
gcgaacccaaaataccataaatattcgccgtttcaaggctactcgtttttgaaagaagcc
gtagcggcgttttacgcgcgcgagtacggggtgacgatcgacccggcccgcgaggtcgcc
atcttgttcggcggcaaagccgggcttgtcgagctgccgctttgcctcgtcaacccgggc
gatgtcgtgctcgtcccggacccgggttatccggactattggtcgggaatcgcgctcgcc
cgcgcgcggatggaaatgatgccgcttgtcgcggagaatgggtttctgccggattattcg
gccattcccagggcggcggccgaccgggcgaaactgatgtttttaaactatccgaacaac
ccgaccggcgcgacggcgacgaaggagttttttgctgaaacggtggcgtttgcggaaaag
tacggcatagccgttgtgcacgattttgcctatggcgcgatcggctttgacggccaaaag
ccggtcagctttctagaagtggacggggcgaaagacattggcgttgaaatctacacgttc
tcgaaaacgtacaatatggccggctggcgcgtggcgttcgctgtcggcaatgagcggatc
atccgtgccattgagttgttgcaagatcatttgtacgtcagcttgttcggcgccgtccaa
gaagcggcggcagctgcgctcctcggcccgcaagactgcgtcgcggagctcgttgccttg
tacgaggcgcgccgcaatacgtttattcatgctttgcgcgcgatcggctgggaagcgccg
gcgccgtctggatcatttttcgcctggcttccgttgccaaaaggcgcatcatccgccgaa
tttgccgatctgttgcttgagcgggcgcacgtcgccgtcgccccaggcatcggttttgga
aaacacggcgaagggtatgtgcgcgttggattgttgaccgatgaagcgcggcttcgcgaa
gcggcggagcggatcggccggctcggattgttttga

DBGET integrated database retrieval system