KEGG   Geobacillus sp. 12AMOR1: GARCT_02130Help
Entry
GARCT_02130       CDS       T03966                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00564  Glycerophospholipid metabolism
gea01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GARCT_02130 (glpD)
Enzymes [BR:gea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GARCT_02130 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_3 GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: AKM19383
UniProt: A0A0G3Y003
LinkDB All DBs
Position
complement(2119062..2120720)
Genome map
AA seq 552 aa AA seqDB search
MVFSSKQRSDVLQAMSEKQYDLLVIGGGITGSGIALDAISRGMTVALVEMQDFAAGTSSR
STKLVHGGLRYLKQFEVKLVAEVGRERAIVYENGPHVTTPEWMLLPIYRGGTFGKWSTSI
GLWLYDRLAGVKQSERRTMLDARQTLEKEPLLKRDGLLGGGYYVEYRTDDARLTIEVVKK
AVELGADAVNYVKAEQFLYDERGRAIGARCRDLIGGRVYDIRAKKVVNAAGPWVDALRDK
DGSKTGKRLRLTKGVHIVIDQKRFPLKQAVYFDTPDGRMVFAIPRDGKTYVGTTDTFYDD
DPAHPAMTEEDRDYLLQAIHYMFPSVGITAADVESSWAGVRPLIYEEGKDPSEISRKDEI
WTSPSGLITIAGGKLTGYRKMAETVVDLVAKQLEKEEGKTFRPCQTKQLPISGGDVGGSH
RLPVFIAEKAKEAARYGLTEEQGARLAKQYGTNVDRLFALSQQYDRSSGLTRETFVRLVY
AIEEEMAAKPVDYFIRRTGALLFDIDAVRREKEAVIAFMARYLGWTEEERDVYEKELDKE
LQRAVLGDERSE
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggtgttctcaagcaaacagcggagcgatgttcttcaagcgatgagcgaaaaacaatat
gatcttctcgtcatcggcggggggatcaccggctctggcatcgccttggatgccatctcg
cgcggcatgacggtcgcgcttgtcgagatgcaagatttcgccgcaggcacgtcgagccgc
tcgaccaaactcgtccacggcggcctgcgctacttaaagcagttcgaggtgaagcttgtc
gcggaagtcgggcgcgaacgggcgattgtgtatgaaaacggcccgcacgtcaccacaccg
gagtggatgctgctgcccatttaccgcggcgggacgttcggaaaatggagcacgtcgatc
ggcctttggctgtatgaccggctggccggcgtcaagcaaagcgagcggcgcacgatgctt
gatgcccggcagacgttggaaaaagagccgctcttaaagcgcgatggcctccttggcggc
ggctattacgtcgagtaccggacggacgatgcccgcttgacgatcgaggtggtcaaaaaa
gcggtcgagcttggcgccgacgccgtcaactacgtaaaagccgaacagtttttgtacgac
gagcgcggacgcgcgatcggcgcccgctgccgcgacctgatcggcggacgagtgtatgac
atccgcgccaaaaaagtcgtcaatgccgccggaccgtgggttgatgcgctgcgcgacaaa
gacggatcgaaaaccggcaagcggcttcggctgacaaaaggcgtccatatcgtcatcgat
caaaagcgttttccgctcaagcaggcagtctattttgacaccccggacggccggatggtg
tttgccattccgcgggatgggaaaacgtatgtcggcacgaccgatacattttatgacgat
gatcctgctcatccggccatgaccgaagaagaccgtgattacttattgcaggcgattcac
tacatgttcccgtccgtcggcatcaccgcggccgatgtggaatcaagttgggccggcgtc
cgtccgctcatctatgaagaagggaaagacccatcggaaatttcccgcaaagacgagatt
tggacgtcgccgtccggcctcattacgatcgctggcggcaaactgaccggctaccggaaa
atggcagaaacggtcgttgaccttgtcgccaaacaattggaaaaagaagagggaaaaacg
ttccgcccgtgccaaacgaaacagctgccaatttccgggggcgatgtcggcggctcgcac
cggctgccggtcttcatcgccgaaaaagcgaaagaagcggcgcgctatgggttgacagaa
gaacaaggggcgcggctggcaaaacagtacggcacaaatgtcgaccggctgtttgcgtta
agccagcaatacgaccgctcgtccggcttaacgcgcgaaacgttcgtccgcctcgtctac
gccattgaggaagaaatggcggccaaaccggtcgactacttcatccgccgcaccggcgcg
ctgctgtttgacattgacgccgtccggcgggaaaaagaagcggttatcgcgtttatggcg
cggtatttggggtggaccgaggaagagcgggacgtgtatgagaaagaactcgacaaggaa
ctgcagcgcgcggtgttgggggacgagcggagtgaatga

DBGET integrated database retrieval system