KEGG   Geobacillus sp. 12AMOR1: GARCT_02184Help
Entry
GARCT_02184       CDS       T03966                                 

Gene name
aroF_1
Definition
(GenBank) Chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gea01100  Metabolic pathways
gea01110  Biosynthesis of secondary metabolites
gea01130  Biosynthesis of antibiotics
gea01230  Biosynthesis of amino acids
Module
gea_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GARCT_02184 (aroF_1)
Enzymes [BR:gea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     GARCT_02184 (aroF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: AKM19437
UniProt: A0A0G3XYB4
LinkDB All DBs
Position
complement(2167576..2168742)
Genome map
AA seq 388 aa AA seqDB search
MRYLTAGESHGPQLTAILEGVPAGLELRAEHINKELARRQKGYGRGRRMQIEKDVVNITA
GVRHGKTLGSPIALVVENRDFKHWQTIMAVEPIDDETEIKRKVTRPRPGHADLNGALKYG
HRDMRNVLERSSARETTVRVAAGAVAKRILEEVGIRVAGHVIEIGGVRAKKLDYRSLEEL
QNVTEESPVRCFDPEAGQKMMEAIDLAKKNGDSIGGIVEVIVEGVPAGVGSYVHYDRKLD
AKIAAAIVSINAFKGVEFGIGFEAARRPGSEVHDEIIWSPEQGFSRRTNRAGGFEGGVTT
GMPIVVRGVMKPIPTLYKPLQSVDIDTKEPFAASIERSDSCAVPAASVVAEAVVAWEVAA
AIVSQFGQDRIDLIKENIERARRYAKEF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacttgacagcaggggagtcgcacgggccgcaattgacggcgattttggaagga
gtgccggctgggcttgagctgcgcgccgagcatatcaacaaggagctggcgcgccggcaa
aaagggtatgggcgcgggcggcgcatgcaaatcgaaaaggacgtggtgaatatcaccgcc
ggcgtccggcacgggaaaacgctcggctcgccgattgcgctggttgtggaaaaccgtgat
tttaaacattggcaaacgattatggccgttgaaccgatcgatgatgaaacggagatcaaa
cgaaaagtgacgcgtccgcgcccgggtcatgccgatttaaacggcgccctgaaatacgga
catcgcgatatgcgcaatgtgcttgaacgctcatcggcaagggaaacgacggtgcgcgtg
gcggccggagcggtggcgaagcgcattttggaggaagtgggcatccgcgtcgccgggcat
gtcatcgaaatcggcggtgtgcgcgcaaagaagcttgattaccgctccctggaggaattg
caaaatgtgacagaagagtcgccggtgcgctgttttgatccggaagcgggacaaaaaatg
atggaagcgatcgatttggcaaagaaaaacggtgattcgatcggcggcatcgtcgaagtg
attgtcgaaggcgttcccgccggggtcggcagctacgttcattacgaccggaagctcgat
gcgaaaatcgcggcggcgatcgtcagcattaacgcctttaaaggcgtcgaattcgggatc
gggtttgaagcggcgcgccgcccgggaagcgaagtgcacgacgaaatcatttggagcccg
gaacaaggcttttcgcgccggacgaaccgcgccggcggctttgaaggcggggtgacgacg
gggatgccgatcgtcgtgcgcggtgtaatgaagccgattccgacgctgtacaaaccgctg
caaagcgtcgacatcgacacgaaagaaccgtttgcggcaagcatcgagcggtcggacagc
tgcgctgtgccggcggcgagcgtcgtcgccgaagcggtcgtcgcctgggaagtggcggcg
gcgatcgtcagccagttcgggcaagaccggatcgatttgattaaagaaaacatcgagcgc
gcccgccgctatgcaaaggagttttaa

DBGET integrated database retrieval system