KEGG   Geobacillus sp. 12AMOR1: GARCT_02625Help
Entry
GARCT_02625       CDS       T03966                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gea  Geobacillus sp. 12AMOR1
Brite
KEGG Orthology (KO) [BR:gea00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GARCT_02625 (ahpF)
Enzymes [BR:gea01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GARCT_02625 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_oxidored FAD_binding_3 NAD_binding_7 Thioredoxin_4 Thi4 AlaDh_PNT_C Glutaredoxin NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AKM19876
LinkDB All DBs
Position
complement(2554565..2556094)
Genome map
AA seq 509 aa AA seqDB search
MLLDADIKTQLAQYLQLLENDIVLTVSAGDDNVSRDMLALIDELTAMSPKIKVEKAKLER
TPSFSVNRVGENTGITFAGVPLGHEFTSLVLALLQASGRPPKVDESVVKRVQNLRGTYRF
ETYVSLTCHNCPDVVQALNIMSVLNPDISHTMIDGAAFKEEAEQKGIMAVPTVFLNGKLF
ASGRMSIEDILAKLGSEPDASDFANKDPFDVLVVGGGPAGAAAAIYAARKGIRTGIVAER
FGGQILDTLAIENFISVKYTEGPKLAASLEEHVKQYDVDVMSSQRAKRLEKKDLIEVELE
NGAVLKSKTVIIATGARWRNLGVPGEDEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIASHVTLLEFAPELKADAVLQNRLYSLPNVTVIKNAQTTEITGTDKVNGLTY
IDRETGEEHHIELQGVFVQIGLVPNTEWLGGTVERNRFGEIIVDKRGATSLEGVFAAGDC
TDSAYKQIIISMGSGATAALSAFDYLIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggatgctgacatcaagacgcaactagctcagtatttgcaattgcttgaaaat
gatattgtcttgacggtaagtgcgggagacgacaacgtttcccgcgatatgcttgcttta
atcgatgaattaacggcgatgtcgccgaaaatcaaagtggaaaaagcgaagctggaacga
acgccaagcttcagcgtcaaccgggtcggcgaaaacaccggcatcaccttcgccggcgtg
ccgctcggccatgaatttacgtccctcgttttggcgctgcttcaagcgagcgggcggccg
ccgaaagtggacgaaagcgtcgtgaagcgcgttcaaaacttacggggcacataccgcttt
gagacatacgtcagcttgacatgccacaactgcccggacgtcgtccaagcgctcaacatt
atgagcgtgttgaacccagacatttcgcatacgatgatcgacggggcggcgtttaaagaa
gaagcggagcaaaaagggatcatggctgtgccgacggtctttttaaatggcaaactgttc
gcgagcggccgcatgtcgattgaagatattcttgccaaattaggaagcgaaccagatgct
tccgattttgccaataaggatccgtttgatgtactcgttgtcggcggtggaccggctgga
gcggcagcggcgatttatgcagcgcgcaaaggcatccgcaccggcattgtagcggagcgt
ttcggcgggcaaattttggacacgctcgctatcgagaactttattagcgtcaaatatacg
gaagggccgaaactggcagccagcctggaagagcatgtgaagcagtacgacgtcgacgtc
atgagttcacagcgcgcaaaacggctcgagaaaaaagacttgattgaagtcgagctagaa
aacggcgctgtgctgaaaagcaagacggtcattatcgccaccggcgctcgctggcgcaac
ctcggtgtgccgggcgaggacgagttcaaaaacaaaggcgtcgcctactgcccgcactgc
gacggcccgctgtttgaaggcaagcatgtggcggtcatcggcggcggcaactccggcgtc
gaagcggcgattgacctcgccggcattgccagccatgtgacgctgctggagttcgcccct
gaactcaaggcggatgctgtgctgcaaaaccggttgtacagcctgccgaacgtaacggtc
atcaaaaacgcgcaaacgacggaaatcaccggcacggacaaagtcaacggcttgacgtac
attgaccgggaaacaggagaagaacatcatatcgaattgcaaggcgtgttcgtgcaaatc
ggccttgttccgaacaccgaatggttgggaggaacggtggaacggaatcgcttcggtgaa
atcatcgtcgataaacgcggtgcgacgagccttgaaggtgtctttgccgcgggcgactgc
acggacagcgcctataagcaaatcattatctcgatgggctcgggtgcaaccgcggcgtta
agtgcgtttgattatttgattcgccattaa

DBGET integrated database retrieval system