KEGG   Geobacillus sp. 12AMOR1: GARCT_02989Help
Entry
GARCT_02989       CDS       T03966                                 

Definition
(GenBank) hypothetical protein
Organism
gea  Geobacillus sp. 12AMOR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LapA_dom
Motif
Other DBs
NCBI-ProteinID: AKM20218
UniProt: A0A0G3Y2P1
LinkDB All DBs
Position
complement(2902685..2902981)
Genome map
AA seq 98 aa AA seqDB search
MKGQLNLLLALVLALVIALMAVANVEQVTIHYLAGETRLPLIVVIFGSAIVGGLVVGMLG
WVRLFSLQRRLKAAEKKNEELAALLEQTERLDTAAAKE
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggcagttgaatttgttgctggcgctcgtgttggcgcttgtcatcgcccttatg
gcagtggccaatgtcgagcaagtgacgatccattatttggccggtgaaacccgcctgccg
ctcattgtcgtcattttcgggtcggctattgttggcggtctcgttgtcggcatgcttggt
tgggtgcgcttgttcagcttgcagcggcggttgaaggcggcggaaaagaaaaatgaggaa
ctggcggcgcttttggagcaaacagagcggctggatacggcggccgcgaaagaatag

DBGET integrated database retrieval system