KEGG   Geobacillus sp. 12AMOR1: GARCT_03009Help
Entry
GARCT_03009       CDS       T03966                                 

Gene name
lytH
Definition
(GenBank) L-Ala--D-Glu endopeptidase precursor
  KO
K21472  peptidoglycan LD-endopeptidase LytH [EC:3.4.-.-]
Organism
gea  Geobacillus sp. 12AMOR1
Brite
KEGG Orthology (KO) [BR:gea00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gea01002]
    GARCT_03009 (lytH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gea01011]
    GARCT_03009 (lytH)
Enzymes [BR:gea01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     GARCT_03009 (lytH)
Peptidases and inhibitors [BR:gea01002]
 Metallo peptidases
  Family M23
   GARCT_03009 (lytH)
Peptidoglycan biosynthesis and degradation proteins [BR:gea01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   GARCT_03009 (lytH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23 SLT_2
Motif
Other DBs
NCBI-ProteinID: AKM20238
UniProt: A0A0G3Y2R1
LinkDB All DBs
Position
2917970..2918962
Genome map
AA seq 330 aa AA seqDB search
MHRWFVALWVATVLFIAASAASAAENDDAVYEQRMELYKKAEAVSLIPWYYFAAIDQYER
NIRQARRDLPKPTGVLGIYMKPDVWAGPLNKNPHDTNPFTISQFGGLGVDGDGDGKARAD
DDDDVIMAMARYLQTYGIDHRHIKIALWNYYQRSKTVDLILGKVKIYKKYKTLKLDDHVF
PLPLRANYSYRDTWGDARGWGGRRIHEGTDIFAGYGVPVRSTCYGIVELKGWNKYGGWRV
GIRDINNTYHYFAHLNGFAAGLREGQIVEPGTIIGSVGSSGYGPPGTAGKFPPHLHYGMY
KDNGYTEWAFDPYPHLKAWERAERQQQRRR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgatggtttgtcgccctatgggtggcgacggtgttgttcatagcggccagcgcg
gcttcggcggcggaaaacgacgacgcagtatacgaacagcgcatggagctgtataaaaaa
gcggaggcggtttcgctcattccatggtattactttgccgccatcgaccagtatgaacgg
aacatccggcaagcgcgccgcgacttgccaaaaccaaccggcgtcctcggcatttatatg
aaaccggacgtatgggccggaccgctgaacaaaaatccgcacgatacgaacccgtttacg
atttcccagtttggcgggctcggtgtggacggagacggggacggcaaggcgcgggcggat
gacgacgacgacgtcatcatggccatggcgcgctatttgcagacatacggcatcgatcat
cgccatattaaaatcgcgctttggaactattaccagcgctccaaaacggtggatttgatt
ttaggaaaagtgaagatttataaaaaatacaagacattgaaactggatgaccatgtcttt
ccgctcccgttgcgggcgaattacagctaccgcgacacgtggggcgatgcgcgcggctgg
ggcgggcgccgcattcatgaaggaaccgacattttcgccggctacggcgtgccggtccgc
tcgacgtgctatggcattgtcgaactgaaaggatggaataaatacggcggctggcgcgtc
ggcatccgcgacatcaacaacacgtaccattattttgcccatttgaacggctttgccgcc
gggcttcgcgaagggcaaatcgtcgagccgggcacgatcatcggctcggtcggcagctcc
ggctacgggccgccgggcaccgctggaaagttcccgccccacctccattacggcatgtac
aaagacaacggctatacggagtgggcgtttgacccgtatccgcacttgaaagcgtgggag
cgggccgagcggcagcaacagcggcgccgctag

DBGET integrated database retrieval system