KEGG   Geobacillus sp. 12AMOR1: GARCT_03050Help
Entry
GARCT_03050       CDS       T03966                                 

Gene name
fadN
Definition
(GenBank) putative 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00071  Fatty acid degradation
gea00362  Benzoate degradation
gea00650  Butanoate metabolism
gea01100  Metabolic pathways
gea01120  Microbial metabolism in diverse environments
gea01200  Carbon metabolism
gea01212  Fatty acid metabolism
Module
gea_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GARCT_03050 (fadN)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GARCT_03050 (fadN)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GARCT_03050 (fadN)
Enzymes [BR:gea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GARCT_03050 (fadN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: AKM20279
UniProt: A0A0G3Y3A7
LinkDB All DBs
Position
complement(2956314..2958701)
Genome map
AA seq 795 aa AA seqDB search
MAKRIRRAAVLGSGVMGSGIAAHLANVGIPTLLLDIVPRELTKEEEAKGWTLEHKQVRNR
LANQALERMKKQKPAPLMAQDNLALIETGNFEDDFHRLADVDWIIEVVVENLDVKRSVFA
RVDEVRTPGTIVSSNTSGISIAAMAEGRSDDFKKHFLGTHFFNPPRYLKLLEIIPTEHTD
PDVVAYMKSFGEDVLGKGVVMAKDTPNFIANRIGTYGLLVTVREMMQGGYSVGEVDSVTG
PLIGRPKSATFRTLDVVGLDTFVHVANNVYENVEGEEKEAFRVPEFMNTMLENGWLGSKS
GQGFFLKQGKDILELNYVTMQYEPRKKLVTPAVEMAKQAKGTAAKLQTLVYADGDRAGTL
LWNIIAPTLLYTARLVGEIADDIVAIDRAMKWGFGWEQGPFELWDAIGLEKSVRKMQAEG
RDVPAWITDMLADGATSFYKTENGRLFYYAPGGYKPVEESEKVIHIRRLKEQRGVIKKNA
GASLIDLGDDVALLEFHSPNNAIGADIVYMINEALEEVNRNYKGLVIGNQGKNFCVGANL
AMMLMEAQDENFFELEIAVRQFQQALMRVKYNPKPVVVAPFAMTLGGGAEVTLAASRIQA
AAETYIGLVEVGVGLIPGGGGNKELYIKQLNSLPRGVDVDYVKIAASVFETIAMAKVSTS
AAEARELGFLNHRDGITMNGDHLLYEAKQAVLSMYEEGYRPPVRKKVPVAGESGYAAMLL
GAQSMFHSGYISEHDLKIAKKLAYVLAGGKVPYGTEVDEQYLLDLEREAFLSLIGEPKTQ
ARMQHMLVKGKPLRN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgcattcggcgcgctgcggtgcttgggtccggcgtcatgggttcgggcatt
gccgcccatttggcgaacgtcggcattccgacgctgctgttggatatcgtgccgcgggaa
ttgacgaaagaggaagaagcaaaaggttggacgctcgagcataaacaagtgcgcaaccgc
ctcgccaatcaggcgctggagcggatgaaaaagcaaaagccggcgccgctgatggctcaa
gacaatctggcgctcattgaaaccggcaactttgaagacgatttccatcggctggcggat
gttgattggatcattgaagtcgtcgtcgaaaacttggatgtcaaacgaagcgttttcgcc
cgcgttgacgaggtgcggacgccggggacgatcgtcagctcgaacacatccggcatctcg
atcgccgcgatggcggaggggcgttcggatgatttcaaaaaacactttttaggcacgcat
ttcttcaatccgccgcgctatttgaagctgcttgaaatcatcccgacggagcataccgat
ccggatgtggtcgcctatatgaaatcgttcggcgaagacgtgctcggcaaaggcgtcgtg
atggcgaaagatacgccgaacttcatcgccaaccggatcggcacgtatggcttgctcgtc
actgtccgcgagatgatgcaagggggctacagcgtcggcgaggttgattcggtgacgggg
ccgctcatcggccggccgaaaagcgcgacgttccgcacgcttgacgtcgtcggactcgat
acgttcgtgcatgtcgccaacaatgtgtatgaaaacgtcgaaggggaagaaaaagaggcg
ttccgcgtgccggagtttatgaacacgatgcttgaaaacggctggctcggcagcaaatct
ggacaagggtttttcctcaagcaaggaaaagacattctcgagctgaactacgtcacgatg
caatacgagccgcgcaaaaagctcgtcaccccggcggtggaaatggcgaagcaggcgaaa
ggaacggccgccaagttgcaaacgctcgtctatgcggacggcgaccgcgcgggaacgctc
ctttggaacatcatcgcaccgacattgctgtacactgcccgccttgtcggggagatcgct
gacgacatcgtggcgatcgaccgggcgatgaagtgggggttcggctgggagcaaggcccg
tttgaactgtgggatgcgatcggcctcgagaagtcggtgcggaaaatgcaggcggaaggg
cgtgatgttccggcgtggatcacggacatgctcgccgacggagccacatcgttctataaa
acggaaaacggccggctgttctattatgcgccgggtgggtataaaccagtagaagaaagc
gaaaaagtcatccacatccgccggctgaaggaacagcggggcgtcatcaagaaaaacgcg
ggtgcaagcctcatcgacctcggcgatgacgtggcgcttttggagttccattcgccgaac
aacgcaatcggtgcggacatcgtgtacatgatcaacgaggcgcttgaggaagtgaaccgc
aattacaaagggctcgtcatcggcaaccaagggaaaaacttctgcgtcggcgccaacttg
gcgatgatgctgatggaagcgcaagatgaaaacttctttgaattggagattgccgtccgc
cagttccagcaagcgctcatgcgcgtcaaatataacccgaaaccggtcgttgtcgcgccg
tttgccatgacgttaggcggcggggcggaagtgacgttggcggcttcgcgcatccaggcg
gcggccgagacgtacatcgggctcgtcgaagtcggcgtcggcttgattccgggcggcggc
ggcaacaaggagctgtacatcaaacagttgaacagcctgccgcgcggcgtggacgtcgac
tacgtcaaaatcgcggccagcgtatttgaaacgatcgccatggcgaaagtgtcgacgtca
gcggcggaagcgcgcgagcttggcttcttgaatcaccgcgacggcatcacgatgaacggc
gaccatctgctgtatgaagcgaaacaggcggtgctctcgatgtatgaggaagggtatcgg
ccacctgtaaggaagaaagtgccggtggccggcgaaagcggctatgcggccatgctgctt
ggggcgcagtcgatgttccattccggctacatcagcgagcacgatttgaaaatcgcgaaa
aaattggcgtacgtcctggccggcggaaaagtgccgtacggaacggaagtcgacgagcaa
tatttgctcgatctcgagcgcgaggcgtttttgagcctcatcggcgagccgaagacgcaa
gcgcgcatgcagcatatgttggtgaaaggaaaaccgctccgcaactaa

DBGET integrated database retrieval system