KEGG   Geobacillus sp. 12AMOR1: GARCT_03238Help
Entry
GARCT_03238       CDS       T03966                                 

Gene name
acoD
Definition
(GenBank) Acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00010  Glycolysis / Gluconeogenesis
gea00620  Pyruvate metabolism
gea01100  Metabolic pathways
gea01110  Biosynthesis of secondary metabolites
gea01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GARCT_03238 (acoD)
   00620 Pyruvate metabolism
    GARCT_03238 (acoD)
Enzymes [BR:gea01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GARCT_03238 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AKM20463
UniProt: A0A0G3Y392
LinkDB All DBs
Position
3159236..3160756
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGALVTFKKRYENFIGGKWVPPVDGEYFENITPITGQPYCEVPRSKAADIEL
ALDAAHAAKDAWGRTSPAERARLLNKIADRMEENLEMLAVAETWENGKPIRETLAADIPL
AIDHFRYFASCIRAQEGTISEIDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIEDLLPPGVVNIVNGFGLEAGKPLASNPRVAKVAFTG
ETTTGRLIMQYASQNIVPVTLELGGKSPNIFFADVMDKDDDFLDKALEGFTMFALNQGEV
CTCPSRALIHESIYDAFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNMLEGELAGGYYVKPTVFKGHNKMRIFQEEIFGPVLAVTTFKDHDEAL
SIANETLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHVYPAHAAFGGYKMSGIGRET
HKMMLDHYQQTKNLLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgcacaaccaggccagccaggcgcgcttgtcacatttaaaaagcgctacgaa
aacttcattggcggcaaatgggtgccgccggtcgacggcgaatattttgaaaacattacg
ccgatcaccggacagccgtattgcgaagtgccgcgctcaaaagcggcggacatcgaactg
gcgcttgacgccgcccatgcggcaaaagacgcatggggacgcacgtctccggcagagcgc
gcccgtttgctgaacaaaatcgccgatcggatggaagaaaacttggaaatgctcgccgtt
gcggaaacatgggaaaacggcaagccgatccgcgagacgctcgcggctgacattccgctc
gccatcgaccatttccgctattttgccagctgcattcgcgcgcaagaaggcacgatttcg
gaaatcgatcacgacacggtcgcctatcatttcaaagaaccgctcggcgtcgtcggacaa
atcatcccgtggaacttcccgattttaatggcggcctggaagctcgctccagcgctcgcg
gccggcaactgcgtcgtcttgaaaccggcggagcaaacgccgacgtcgatcctcgttctc
atcgaactcatcgaagatttgcttccacctggcgtcgtcaacatcgtcaacggctttggc
ttagaagccggcaagccgctcgcctcgaacccgcgcgtggcgaaagtggcgttcaccggt
gaaacgacgaccggacggctcatcatgcaatacgcctcgcaaaacatcgtgccggttacg
cttgagcttggcggcaagtccccgaacattttcttcgctgatgtgatggacaaagacgat
gactttcttgataaagcgcttgaaggctttacgatgttcgccttaaaccaaggcgaagtg
tgcacatgcccgtcgcgcgccctcatccatgagtcgatttacgacgcctttatggaacgg
gcgcttgagcgcgtcaagcaaatcaagcaaggcaatccgctcgatacggaaacgatgatc
ggcgcgcaagcctcctccgaacagctcgagaaaattttgtcatacatcgacatcggcaaa
caggaaggcgctgagctcttgatcggcggcgagcggaacatgctcgaaggagaactcgcc
ggcggctattacgtcaagccgaccgttttcaaagggcataacaaaatgcgcattttccaa
gaagaaattttcggcccagtgctcgcggtcacgacgtttaaagatcatgacgaagcgctt
tcgatcgccaatgagacgctgtacggccttggcgccggcgtctggacgcgcgacatcaac
accgcgtaccggttcggccgcggcatccaggctggccgcgtctggacgaactgctatcac
gtctatccggcccatgcggcgttcggcggctacaaaatgtccggcatcggccgcgaaacg
cacaaaatgatgctcgaccattatcaacaaacgaaaaacttgctcgtcagctattcgccg
aaaaaacttggcttgttctga

DBGET integrated database retrieval system