KEGG   Geobacter sp. M18: GM18_0118Help
Entry
GM18_0118         CDS       T01421                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
geb  Geobacter sp. M18
Pathway
geb00500  Starch and sucrose metabolism
geb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GM18_0118
Enzymes [BR:geb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GM18_0118
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     GM18_0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH DUF3459 AAA_lid_2
Motif
Other DBs
NCBI-ProteinID: ADW11607
UniProt: E8WL27
LinkDB All DBs
Position
142249..145593
Genome map
AA seq 1114 aa AA seqDB search
MPFRSEKNPLWYKDAIIYEVHIRSFCDSNGDGIGDFRGLLQKLPYLRDLGITAVWVLPFY
PSPLRDDGYDIADYRSVHPDYGTLRDFQDFLKGAHALGMRVITELVLNHTSDQHPWFQKS
RNAKPGSPWRDFYVWSDTPDKYLDARIIFKDFEVSNWTRDPVAKSYYWHRFYSHQPDLNY
DNPRVHDAMLRVIDFWLDMGVDGLRLDAVPYLYEREGTNCENLPETYEFLKKLRAYIDAR
YPDKMLLAEANQWPEDAASYFGGGAACQMAFHFPLMPRMFMALQMEDSFPIVNIMQQTPA
IPQQCQWAMFLRNHDELTLEMVTDEERDYMYRIYARDPRARINLGIRRRLAPLMGDDRRK
IELMNALLFTMPGTPIIYYGDEIGMGDNYYLGDRNGVRTPMQWSPDRNAGFSPANPQKLY
LPAIIDPEYHYEARNVENQAKNPSSLLWWMKRMIDLRKRFKAFGWGTLEFITLDNPKVLA
MLRKYEDQTILVLINLSRATQFVQVNQPRFVGFYVEEMFSRNRFPAIKDSPYGIIMGPYD
YHLMLLTDGREKTKPREEGVLEEVVVTGSWENVLKSAGLRQLEQSVLPDYLSKSRWFQGK
SRIMVRFSVVDKLPVPIDSSSVILAFLEVSYSEGAPDVYLLPLHYLPMDGGGETLLGTSP
EAIICQLRVGERLGVLYDGLYNSHFRWVLFELIWRRKSLRGDGGRLSGRPAAGMQALMEG
KEPPFPSRVGKTEQSNSSVIFEKSFFLKMYRRMEEGAHPELEIGRFLSDRVRFPHVAPLG
GTLEYRRGSGETLALGLLQEFVPNQGDAWAFTLGEVGQYVDRVLAHREEAKKSGLEPHPG
NESSGYTPALLELIQGFYPDMVALIGKRTAEFHLALASRGDDPAFTPEPFALLYQRSVYQ
SMRSHCRKVFDLLRKNMARIPQHVASDAEELLELENEVLAVFQKFMVRKFGAMKTRVHGD
YHLGQLLYTGDNFLIIDLEGEPIKSLGERRIKQSPLRDVAGMVRSFHYAAHAVLMQRTQV
RDEDIAYLLPWVDAWYRYISSIFLRAYRKGVSGAEFMPAERDEVEIMLQTFMLDKAIYEL
GYELNNRPEWVSIPLSGILDLLALGPSAAKGEGR
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgcagcgaaaagaacccgctctggtacaaggacgccatcatctacgaggtg
cacatcaggagtttttgcgacagcaacggggacggtatcggcgacttccgggggctgttg
cagaagctcccctacctgcgcgacctggggatcacggcggtctgggtgctcccgttctat
ccctcgccgctgagggacgacggctacgacatcgcggactaccgcagcgtgcaccccgac
tacggcaccctgcgcgacttccaggatttcctcaagggggcgcacgccttggggatgcgg
gtcatcaccgagctggtcctgaaccacacctcggaccagcacccctggttccagaaatcg
cgcaacgccaagcccggctcgccctggcgcgacttctacgtctggagcgacacgccggac
aagtacctggatgccaggatcatcttcaaggacttcgaggtctccaactggacccgcgat
ccggtggccaagagctactactggcaccgcttctactcgcaccagcccgatctcaactac
gacaacccccgggtgcacgatgcgatgctccgggtgatcgacttctggctcgacatgggg
gtggatggcttgaggctcgacgccgttccctacctgtacgagcgggaggggaccaactgc
gagaacctcccggaaacctacgagtttttgaagaagctgcgcgcctacatcgacgccagg
taccccgacaagatgcttctcgccgaggcgaaccagtggcccgaggacgccgcctcctac
ttcggcggcggggccgcctgccagatggccttccacttccccctcatgccccgcatgttc
atggccctgcagatggaggactcgtttcccatcgtcaacatcatgcagcagaccccggcc
atcccgcagcagtgccagtgggccatgttcctgagaaaccacgacgagctcaccctggag
atggtgaccgacgaggagcgggactacatgtaccgcatctacgcccgggacccccgcgcc
cgcatcaacctcggcatccggcgccgcctcgcgcccctcatgggggacgaccggcgcaag
atcgagctgatgaacgcgcttctcttcaccatgcccgggacccctatcatctactacggt
gacgagatcggcatgggggacaactactacctgggcgacagaaacggcgtgcgcaccccg
atgcagtggagcccggaccgaaacgccgggttctccccggccaacccgcagaagctctac
ctccccgccatcatcgacccggagtaccactacgaggcgcgcaacgtcgagaaccaggcc
aagaacccctcgtcgcttttatggtggatgaagcggatgatcgacctcagaaagcgtttc
aaggcctttggctgggggacgctggagttcatcacgctggacaaccccaaggtgctggcc
atgctgcgcaagtacgaggaccagaccatcctggtgctgatcaacctctcccgcgccacc
cagttcgtgcaggtgaaccagccgcgcttcgtcggcttctacgtcgaggagatgttcagc
cgcaaccgtttcccggccatcaaggactccccctacggcatcatcatgggaccctacgac
taccatctgatgctgctgaccgacgggcgcgagaagaccaagccgcgcgaggaaggggtg
ctggaggaggtcgtggtcaccgggagctgggagaacgtgctgaagtcggccggcttgcgg
cagctggagcagtccgtgctgccggattacctgagtaaatcccgctggttccagggcaag
agccgcatcatggtccgcttttcggtggtggacaagctgccggtgccgatcgacagctcc
tcggtgatcctggcgttcttggaggtgagctacagcgaaggggcgcccgacgtgtacctg
ctgccgctgcactacctccccatggacggtggcggcgagaccctgctcgggacctctccc
gaggcgatcatctgccagctccgggtcggggagaggctgggggtgctctacgacggcctc
tacaactctcacttccgctgggtgctcttcgagcttatctggcgcagaaaatccctgcgc
ggcgacggggggaggctctccggccgtcccgccgccgggatgcaggcgctcatggaaggg
aaggagccccccttcccctcgcgggtggggaaaaccgagcagagcaacagctctgtcatc
ttcgaaaagagcttcttcctcaagatgtatcggcgcatggaggagggagcgcatccggag
cttgagatcggcaggttcctctcggaccgggtccgtttcccgcacgtggcgcccctgggg
ggaaccctggagtaccggcgcggcagcggggaaaccctggcgctggggctcttgcaggag
tttgtccccaaccagggggatgcctgggccttcaccctcggggaggtggggcagtacgtg
gaccgggtgctcgcccaccgcgaggaggcgaagaagtcggggcttgagccccatcccggc
aacgagtccagcggctacaccccggcgcttttggagctgatccaggggttctacccggac
atggtggctctgatcggcaagcgcaccgcggaattccacctggcgctcgcctcccgcggc
gacgaccccgccttcacacccgagcctttcgcgcttttataccagcgctccgtgtaccag
tcgatgcgcagccactgcaggaaggtcttcgacctgctgcgcaagaacatggcccggata
ccgcagcacgttgccagcgacgccgaggagctcctcgagttggagaacgaggtgcttgcc
gtctttcagaagttcatggtgcgcaagttcggcgcgatgaagacccgggtgcacggcgac
taccacctggggcaactgctctacaccggcgacaacttcctcatcattgacctggaggga
gagccgatcaagtcgctcggcgagcgcaggatcaagcagtcgccgcttagggacgtggcc
gggatggtgcgctccttccactacgccgcgcacgcggtgctcatgcagcggacccaggtt
cgcgacgaggacatcgcctacctgctcccctgggtggatgcctggtaccgttacatctcg
tcgatcttcctgcgagcctaccggaagggggtgtcgggagccgagttcatgcctgcggag
cgcgacgaggtagagataatgctgcagacgttcatgctggacaaggcgatctacgagctg
gggtacgagctcaacaaccggccggagtgggtttccatcccgctctccggcatcttggat
cttctcgccctggggccgagcgctgccaagggtgagggccgctga

DBGET integrated database retrieval system