KEGG   Geobacter sp. M18: GM18_3884Help
Entry
GM18_3884         CDS       T01421                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
geb  Geobacter sp. M18
Pathway
geb00473  D-Alanine metabolism
geb00550  Peptidoglycan biosynthesis
geb01100  Metabolic pathways
geb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:geb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GM18_3884
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GM18_3884
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    GM18_3884
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:geb01011]
    GM18_3884
Enzymes [BR:geb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GM18_3884
Peptidoglycan biosynthesis and degradation proteins [BR:geb01011]
 Precursor biosynthesis
  Amino acid ligase
   GM18_3884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 RimK GARS_A TTL ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ADW15306
UniProt: E8WSF9
LinkDB All DBs
Position
complement(4542009..4542926)
Genome map
AA seq 305 aa AA seqDB search
MTVDELKTKKIAVLMGGLSAEREVSLNSGKAVLASLVRQGYQAVGIDVGRDLPQRLAEEQ
VERAFIALHGRFGEDGSVQGLLELMAIPYTGSGVLASALAIDKIAAKTMFAAAGLKLAPY
QVLSRGEELKLANPLPVVVKPSREGSSVGVSIVREPQQMEKALAEAFRYDSEILIEAFID
GKEVQVGILDGRAMGAIEIVPKNEFYDYEAKYTDGGAEHILPARLPEQVYQAVLKEGEKA
HAALGCDCYSRVDFLVNEAGECYLLEVNTLPGMTDLSLLPEIARGSGIDFDQLVQRILLA
ASLKI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtagatgagctcaagaccaagaagatcgccgtgctgatgggggggctttccgcc
gagcgcgaggtgtccctcaacagcggcaaggcggtgctcgcctccctggtgcgccagggg
taccaggctgtcgggatcgacgtcgggcgcgacctgccccagcggctggcagaggagcag
gtggagcgtgccttcatcgccctgcacggccgcttcggcgaggacggctccgtccagggg
ctcctcgagctgatggcgatcccctacaccggctccggtgtcctcgcctcggccctcgcc
atcgacaagatcgccgccaagacgatgttcgccgccgcaggactgaagctcgccccctac
caggtgctctcccgcggcgaggagctgaagctcgcaaacccgctccccgtggtggtgaag
ccgtccagggaaggctcctcggtaggcgtcagcatcgtgcgcgagccgcagcagatggag
aaggcgctcgcggaggccttccgctacgactccgagatcctcatcgaggcgttcatcgac
ggcaaagaggtgcaggtcggcattctggacgggcgcgccatgggcgccatcgagatcgta
cccaagaacgagttctacgactacgaggccaagtacaccgacggtggtgccgagcacatc
ctcccggcccgtctgccggaacaggtgtaccaggcagtcctcaaggaaggggagaaggcc
catgcggcgcttggctgcgactgctacagccgggtggacttcctggtgaacgaggcaggc
gagtgctacctcctcgaagtgaacaccctgccgggcatgacggacttgagtctgctcccg
gaaatcgcccgcggttcaggcatagactttgatcaactggtgcagcggatacttttggcc
gcatcgctaaaaatctga

DBGET integrated database retrieval system