KEGG   Geobacter sp. M18: GM18_4250Help
Entry
GM18_4250         CDS       T01421                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
geb  Geobacter sp. M18
Pathway
geb00500  Starch and sucrose metabolism
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:geb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GM18_4250
Enzymes [BR:geb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     GM18_4250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 DUF5624
Motif
Other DBs
NCBI-ProteinID: ADW15664
UniProt: E8WI39
LinkDB All DBs
Position
4994013..4996565
Genome map
AA seq 850 aa AA seqDB search
MNLFSTLHRFTVVPSLPRELSGLQRIAYNLWWSWEPEAIGLFKRLDPELWRATRHNPLEM
LGCLQQATFESLMLDEGFMSHLARVEERLTEYLASRTWYERHGNPRARIAYFSMEFGLHE
SLPIYSGGLGILAGDHLKSASDLGLPLVGVGLLYRQGYFRQYLNLEGWQQEIYPENDFYN
LPLHLERDAEGKPLILELEYPGRNVRVQIWRVQAGRVRLYLLDTNVEENAPADREITTRL
YGGDQEMRIRQEILLGIGGIRALRLLGVEPNVCHMNEGHAAFLALERIRILMEERSLSFG
EAREAVRSGNVFTTHTPVEAGIDHFPPELLERFLGQYYRRLGLSHDQFLALGMQNHGRSN
ENFCMAVLAMKLSLHSNGVSELHGMVSRRMWADIWPDLPEEQLPLTYVTNGVHQKSWLSE
EMSGLLTRYLGTRWLEQSDDALWRKVSRIPDAELWRTHRRGTERLVDYARSSLKAQLQKL
DASAKEIDQAADVLDPEILTIGFARRFTTYKRGTLLLHDKERLERVLNHPERPVQIVFAG
KAHPADHQGKELIRQIVQLSQQDKFRRRIVFLEDYDISVARRLVQGVDIWLNTPLRPQEA
SGTSGMKVAFNGGLNMSVLDGWWCEGYRGNNGWAIGRGEVYDDLDYQNEVESRAIYDLLE
KEIVPLFYNRGSDGVPRGWTAFMKASMQTLCPEFSTDRMVQEYARRCYLPAFEHWERLNR
DGLRLAVELARWKERLHGLWGGLSIVEVQAECKREVTVGQKVPITVQITPGEVPLSEIAV
EVYFGVLDSRGAIVGGEVVPLEPAAEPERSGRFCGELECRFCGRHGFLLRVMPRHPELGT
VYDPGLILWG
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcttctcgacgctgcaccgattcacagttgtcccttcgctccccagggagctc
tccgggctgcaacgaatcgcatacaacctctggtggagctgggaaccggaggccatcgga
cttttcaagcgcctcgacccggaactgtggcgggctacgcgccacaatcccctggagatg
ctggggtgcctgcagcaggcgaccttcgagagcctgatgctggacgaggggttcatgtcc
cacctcgcccgggtggaggagcggctcacggagtacctcgcctcccgcacctggtacgag
cggcacggcaacccccgggcgcgcatcgcctacttctccatggagttcggcctgcacgag
tcgctccccatctattcgggcggcctcgggatcctcgccggcgaccacctgaagtcggcc
agcgacctcgggctcccgctggtgggagtcggtctcttgtaccgccaggggtacttccgg
cagtacctgaacctcgaggggtggcagcaggagatctacccggagaacgacttctacaac
ctgccgctgcacctggagcgggacgcggaaggaaagccgctcatcctggagctggagtac
ccggggagaaacgtccgggtgcagatctggcgggtacaggccgggcgggtgcgcctctac
ctcctggacaccaacgtggaggagaacgccccggccgaccgcgagatcaccaccaggctc
tacggcggcgaccaggagatgcgcatcaggcaggagatcctgctcggcatcggcggcatc
cgggcgctgcgcctgctgggggtcgaaccgaacgtctgccacatgaacgaggggcacgcc
gccttcctcgccctggaaaggatcaggatcctcatggaggagcgctcgctcagcttcggc
gaggcgagggaggcggtccgcagcggcaacgtcttcaccacccataccccggtcgaggcc
ggcatcgaccacttccctccggaacttctggagcgcttcctcgggcagtactaccgccgc
ctggggctcagccacgaccagttcctcgccctggggatgcagaaccacggccgcagcaac
gagaacttctgcatggcggtcctggccatgaaactctcgctccactcaaacggggtgagc
gagctgcacggcatggtttcacgccggatgtgggccgacatctggcccgaccttcccgaa
gaacaactccccctcacctacgtcaccaacggtgtgcaccagaagagctggctttccgag
gagatgagcggccttctgacccgctatctcggcacgcgctggctggagcaaagcgacgac
gcgctctggcgcaaggtttcgcgcattccggatgccgagctgtggcgcacccaccgccgc
ggcaccgagcgcctggtcgactacgcccgcagcagcctgaaggcgcagctgcaaaagctc
gatgcgagcgcgaaggagatcgaccaggccgccgacgtgctcgacccggagatactcacc
atcgggtttgcacgccgcttcacaacctacaagcggggcacgctccttttgcacgacaag
gagcggttggagcgggtcctgaaccacccggagcgcccggtacagatcgtctttgccggg
aaggcacatccggccgaccaccaggggaaggagctgatccggcagatcgttcagctctcg
cagcaggataagttccggcgccgcatcgtgttcctggaggattacgacatctccgtggcc
cgccgcctggtgcagggggtcgacatctggctgaacaccccgctgaggccccaggaggcc
agcggcaccagcggcatgaaggtcgccttcaacggcgggctgaacatgagcgtcctggac
ggctggtggtgcgaagggtaccgggggaacaacggctgggccatcgggcggggcgaggtg
tacgacgacctcgactaccagaacgaggtggagagcagggccatctatgacctcctggag
aaggagatcgtgccgcttttctacaaccgggggagcgacggcgtgccgcgcgggtggacc
gccttcatgaaggcctcgatgcagaccctctgcccggaattcagcacggaccgcatggtg
caggagtacgcccggcgctgctacctccccgccttcgagcactgggagcgcctgaaccgg
gacggcctgaggctcgccgtggaactggcacgctggaaggagcgcctgcacgggctctgg
ggggggctctccatcgtcgaggtccaggccgaatgcaagcgggaggtgacggtggggcag
aaggtcccgatcacggtgcagatcacgccgggagaggtgccgctctccgagatcgccgtg
gaggtctacttcggggtgctggattcacggggcgccatcgtcgggggtgaggtggtgccg
ctggaacccgccgccgagccggaaaggagcggccgcttctgcggcgagctggaatgccgc
ttctgcgggcggcacggtttccttttgagggtcatgccgcggcacccggaactgggtacc
gtctacgacccgggtctgatcctctgggggtga

DBGET integrated database retrieval system