KEGG   Candidatus Gullanella endobia: FVIR_GE00154Help
Entry
FVIR_GE00154      CDS       T04502                                 

Gene name
trpE
Definition
(GenBank) Anthranilate synthase component 1
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
ged  Candidatus Gullanella endobia
Pathway
ged00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ged01100  Metabolic pathways
ged01110  Biosynthesis of secondary metabolites
ged01130  Biosynthesis of antibiotics
ged01230  Biosynthesis of amino acids
ged02024  Quorum sensing
Module
ged_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ged00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FVIR_GE00154 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    FVIR_GE00154 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FVIR_GE00154 (trpE)
Enzymes [BR:ged01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     FVIR_GE00154 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: CUX95963
UniProt: A0A143WQJ8
LinkDB All DBs
Position
I:complement(272173..273735)
Genome map
AA seq 520 aa AA seqDB search
MPTSHYQIELLYTQALYRPDPTAIFNHLCGTRPATLLLESAEIDKKHDLESMMVVDSALR
ITAIGQTVTLQAMSGNGAALLPLLDAALPKNVMITAYPYKRKLTFPILTQDIDEDTRLRS
LSVFDCLRLLLTLVNQPIDAPKAMFIGGLFSYDLVASFESLPSLHPRQRCPDYCFYLAET
LLILDHQKQTCKLQCSLFNHNPLEKERLQYRLKQLQYQLTKTLDPIPHQVINNMTLTCNQ
NDEEYAQIVCRMQKAIREGEVFQVVPSRRFSLPCPSTLAAYHTLKKNNPSPYMFFMQDNK
FTLFGASPESSLKYTPDTRQIEIYPIAGTRPRGRRDDGSLDVDLDSSIELEMRSDHKELA
EHLMLVDLARNDLARICEPGTRYVADLTKVDRYSFVMHLVSRVVGQLRSDLDILHAYRAC
MNMGTLSGAPKIRAMQLIAEVEGERRGSYGGAIGYFTASGMLDSCIIIRSAYVEDGIATV
QAGAGIVLDSIPQVEADESRNKARAVLRAIAMAHSAKELF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccagtcactatcagatagaattactatatacgcaagctctttaccgccccgat
ccaacagctatatttaatcatttatgcggtacacgacctgcgacattattgctagaatca
gctgagatcgataagaaacatgatttggaaagcatgatggtagttgatagcgcgttacgt
attacagctattggtcaaacagtcacattacaggcaatgagcggaaacggcgctgcgctg
ttgccgctattagatgctgctttaccaaaaaatgttatgattactgcttatccctacaag
cggaaattaacatttccaatattgacacaagatatagatgaagatactcgtctacgttca
ttgtcggtattcgattgtctacgtttactcttaacgctagttaatcaaccaatagatgca
ccaaaagcaatgtttattggtggacttttttcttatgatctcgtcgcaagctttgaatct
ttgccttcgcttcatccaagacagcgttgtcccgattactgtttttatttagcggaaacg
ctactaattcttgatcatcaaaaacaaacttgtaaattgcaatgtagtttatttaatcac
aatccgctagaaaaggaacgcttacaatatcgacttaaacaattgcagtatcaacttacc
aaaacactagatccaattccgcatcaggtcatcaataatatgactttaacttgcaatcaa
aacgatgaagagtatgctcaaattgtatgccgaatgcaaaaggcgattcgagaaggggaa
gttttccaggttgttccttctcggcgtttttcacttccttgcccctctacgctcgctgct
tatcatacgcttaaaaaaaataatccaagtccatacatgttttttatgcaggacaataaa
tttaccctatttggtgcctcaccagaaagctcgctgaaatacactcctgacacaagacaa
attgaaatttaccccatagccggtacgcggccacgtgggcgacgcgatgacggatcattg
gatgttgatcttgatagtagtattgaacttgaaatgcgttctgatcataaagaattagca
gagcatttaatgttagtagatttagcacgaaatgatttagcacgtatttgtgaaccaggc
acccgatatgtagctgatttaactaaagtcgatcgttattctttcgtaatgcatctagtt
tctcgagtagtaggtcaacttcgttctgatcttgatatattacacgcctatcgtgcctgt
atgaatatgggtactttaagcggagcaccaaaaattcgtgcaatgcagcttatcgccgaa
gtagaaggtgaacgtcgtgggagttacggtggtgcaattggatattttactgcttccggc
atgctcgacagttgtatcattatccgttctgcgtatgttgaagatggtattgctacagta
caagctggcgcaggtatagtgctagattctattccacaagtagaagctgatgaaagtcga
aataaagctcgcgctgtcttgcgtgctattgctatggctcacagtgcaaaggagttattt
taa

DBGET integrated database retrieval system