KEGG   Candidatus Gullanella endobia: FVIR_GE00313Help
Entry
FVIR_GE00313      CDS       T04502                                 

Gene name
rpiA
Definition
(GenBank) Ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
ged  Candidatus Gullanella endobia
Pathway
ged00030  Pentose phosphate pathway
ged01100  Metabolic pathways
ged01110  Biosynthesis of secondary metabolites
ged01120  Microbial metabolism in diverse environments
ged01130  Biosynthesis of antibiotics
ged01200  Carbon metabolism
ged01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ged00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FVIR_GE00313 (rpiA)
Enzymes [BR:ged01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     FVIR_GE00313 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: CUX96175
UniProt: A0A143WR01
LinkDB All DBs
Position
I:complement(562472..563128)
Genome map
AA seq 218 aa AA seqDB search
MTLDELKKAVGWAALKYIRPGTIVGVGTGSTTAHFINILASLKHKIEGVISSSEASSKKF
QSLGIPLFDLNEMESLDVYIDSADEINSKMQMIKGGGAALTREKVIAAVARKFICIIDSS
KLVKVLGAFPLPVEVIPMARAWVSRELVRLGGSPVYRQGVVTDNSNIILDVHNLAIIDAV
ALEETINNIPGVVTVGLFARRVADVVLISNEQGIKIID
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgactctggatgagctaaaaaaagcagttgggtgggccgcattaaaatatattcgacct
ggtacaattgttggcgttggaaccggttctaccacagcgcattttattaatatactagct
tcactaaaacataaaatcgaaggagttatatctagctctgaagcatcatctaaaaaattt
caaagtttaggtataccattattcgatctaaatgaaatggaatctcttgatgtttacatc
gatagtgctgatgaaattaatagtaaaatgcagatgatcaaaggtgggggagctgcacta
actcgagaaaaagttattgcagccgtagcgcgtaagtttatctgtattatcgattctagt
aaactagtaaaagtactcggcgcatttcctcttccagtggaagtaattcctatggcacgt
gcttgggtatctcgtgaattagttcgattaggtggttcgccggtctatcgccagggagta
gtaactgataacagcaatatcatcctagatgtccacaatttggctattatagatgcagta
gcacttgaagaaacaattaacaatattccaggcgttgttactgttggtctattcgcacgt
cgcgtcgctgatgtagtattaattagtaatgaacaaggcataaaaattattgattag

DBGET integrated database retrieval system