KEGG   Candidatus Gullanella endobia: FVIR_GE00495Help
Entry
FVIR_GE00495      CDS       T04502                                 

Gene name
ftsI
Definition
(GenBank) Peptidoglycan synthase FtsI precursor
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
ged  Candidatus Gullanella endobia
Pathway
ged00550  Peptidoglycan biosynthesis
ged01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ged00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FVIR_GE00495 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    FVIR_GE00495 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ged01011]
    FVIR_GE00495 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ged03036]
    FVIR_GE00495 (ftsI)
Enzymes [BR:ged01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     FVIR_GE00495 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:ged01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   FVIR_GE00495 (ftsI)
Chromosome and associated proteins [BR:ged03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    FVIR_GE00495 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CUX96335
UniProt: A0A143WRF9
LinkDB All DBs
Position
I:complement(878752..880509)
Genome map
AA seq 585 aa AA seqDB search
MKIALYKIKLKHKENKNNFVSWRFALLCSCIILSLLGLMFRVAYLQIINPDKLVREGDMR
SLRFQKIPITRGIISDRAGHPLAVSVPVNAIWADPKELNDHGGISSDNRWKALSNALSMS
IDYLSSRINNNPKGRFIYLARQVNPAIGEYVHKLKLPGIYLRQESRRYYPSGQVTAHLIG
VTNIDNQGIEGIEKSFDYWLTGQPGKRTIRKDRFGRVIEDISYVESQKAQNLVLSIDKRL
QALVYRELNNAVVLNKAESGTAVLVDVNTGEILAMANSPSYNPNNLTNTTMSVMRNRAIT
DIFEPGSTVKPMVVMTALQHHVIQENSVLNTLPYMIGKHQIKDVMCYDELSVSGILQKSS
NVGVSKLALAMPSSALIKTYSCFGLGKTTNLGLIGENSGLYPHKKRWSEIERATFSYGYG
FMVTPLQLARVYATIGSMGIMRPLSITRVNSPVMGYQVFPKSLVRTVVHMMESVALQKNI
TKAAIKGYRVAVKTGTTKKVWLNGNYINKYIAYAAGIAPASNPRFSLVVVINDPKGGKYY
GAAVSSPVFGTVMSNVLRIMNIKPDSLPQLNEKSKMIINNQKRGI
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgcattatataaaataaaactaaaacacaaagaaaacaaaaataactttgtc
agctggcgttttgctttattatgcagttgtattatactatcactactaggactaatgttt
cgggttgcctacttacaaataattaatccagataaactagttcgcgaaggggatatgcgt
tctcttcgctttcagaaaattccaattacacgtggcataataagcgatcgagctggtcat
ccattagcagtaagcgtaccagtcaacgctatctgggctgatcctaaagaactcaatgat
cacggtggtatcagtagtgataatcgatggaaagcgctgtccaatgcactttctatgtct
attgattatctctcttcacgcattaataataatcccaaagggcgttttatctatctagcg
cgtcaggttaatcctgctatcggagagtatgttcataaactgaaacttcctggtatttac
ctgcgtcaagaatcgcgacgctattatccatcaggtcaagttactgcacatctcattggt
gtgactaatattgacaatcagggtattgaaggtattgagaagagttttgactactggctg
actggccagcctggaaagcgtacgatacgtaaagaccgattcggtcgggttattgaagat
atttcctatgtggaaagtcaaaaagctcaaaatctagtgctaagtatcgataaacgtctg
caagcgctagtatatcgcgaattaaataatgcagtagttttaaataaagctgagtccggt
accgccgtattagtagatgtcaatactggcgaaatattagctatggcaaacagtccttct
tacaatccaaataatcttaccaatactacgatgagtgtaatgcgaaatcgtgctattacc
gatatttttgagccaggatcaacagtcaaaccaatggtggtaatgactgcactacagcat
catgtgatacaagaaaacagcgtattaaatactttgccttatatgattggaaagcatcaa
attaaagatgtaatgtgctatgacgaattaagtgtaagcggaattttgcaaaaatctagt
aacgttggtgtatctaagctagcattggcgatgccatcttcggcgctaataaaaacttat
tcttgttttggattaggcaaaacgactaatttaggattaataggagaaaatagtggttta
tatcctcataaaaaaaggtggtctgaaatagaaagagctactttctcttatggttatgga
tttatggtaacaccattacaattagctcgagtttatgccacaattggcagcatgggtata
atgcgtcccctttctattactcgggtaaattctcctgtaatgggatatcaagtatttcct
aaatctttagtacgtactgtggtccatatgatggaaagtgtagcactacaaaaaaatatt
acgaaagctgctattaagggataccgcgtcgcggtgaaaactggtactactaaaaaggtc
tggttaaatggtaattatattaataaatatattgcatatgctgctgggattgcgccggcg
agtaatccgcgattttcgctagtagtggtaattaatgatccaaagggcggaaaatattat
ggtgcggcagtttcttctccagtatttggtacggttatgagtaatgtactacgtattatg
aatataaagccggattcattaccgcagctcaatgaaaaatctaagatgatcattaataat
caaaaaagaggcatctga

DBGET integrated database retrieval system