KEGG   Candidatus Gullanella endobia: FVIR_GE00504Help
Entry
FVIR_GE00504      CDS       T04502                                 

Gene name
spoVD
Definition
(GenBank) Stage V sporulation protein D
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
ged  Candidatus Gullanella endobia
Pathway
ged00550  Peptidoglycan biosynthesis
ged01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ged00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FVIR_GE00504 (spoVD)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    FVIR_GE00504 (spoVD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ged01011]
    FVIR_GE00504 (spoVD)
Enzymes [BR:ged01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     FVIR_GE00504 (spoVD)
Peptidoglycan biosynthesis and degradation proteins [BR:ged01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   FVIR_GE00504 (spoVD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CUX96343
UniProt: A0A143WRN6
LinkDB All DBs
Position
I:complement(892717..894609)
Genome map
AA seq 630 aa AA seqDB search
MKIERNPFYSYSAKPLLFFRRALLALISILLVTGVLIVNLYYLQIICFEDYCTRSNENRI
RLVPISPSRGIIYDRNGIPLALNRSIYQLELIPEKVSNLTQTIADLRAIVCLSDDDIANF
EKERERSCRFASLPLKIGLTDVQQARFAVNQYRFPGVKVKCYQRRYYPYGSAFTHVIGYV
SKINDRDVKLLNKEGMLSNYAATHNIGKLGIERYYESTLHGKAGYKEIEVNNRGRVIRQL
YERLPQAGKDIILTLHLSLQRYIETLLIGTRSAVVVFDPRDGGILALVSNPSYDPNMFVN
GISAKKYHALLEDKNYPLINRTTQGIYPPASTVKPYISVSALTLGIINENFSLFDPGWWQ
LPDSKKRYRDWKRWGHGQLNITRALEESSDTFFYQVVYNMGIDRLSEWMKKFGYGQYTGI
DLAEEYSGVMPTREWKFARFKKPWYQGDTIPVAIGQGYWTATPLQMSKAMMTLINDGTVQ
IPHLLYGIQENDYQIPYRQPKNIQIGDPNSGFWEIVKDGMFGVANRPNGTACKSFSDAPY
KAAVKSGTAQVYGLKTNEIYNANKIAEHLRDHKLMTAFAPYNKPTVGVVVILENGGVGPT
AGEITRQILDYILLKDDTVDFSLKTSRQAK
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagaacgtaatcctttttacagttattcagccaagccgctgttgttttttcgt
cgtgcactactagcgcttattagcatattactagtaaccggtgtccttattgttaattta
tactatttgcaaattatttgtttcgaggattactgcactcggtctaacgaaaatcgtatc
aggctagtacctatttcgccgagccgcggtattatttacgatcgtaatggcataccctta
gcattaaatagaagtatttatcaattagaactgataccggaaaaggtaagcaatttaaca
cagacaattgccgatctgcgtgcaattgtctgtttatccgatgatgatattgctaatttt
gaaaaagagcgtgaacgctcctgccgttttgcttcacttccgcttaaaattggattaact
gatgtacaacaggccaggttcgctgtaaaccaataccgttttccaggtgttaaagtaaaa
tgctatcagcgaagatattatccttacggttcagcattcactcatgttattggttatgtg
tcgaaaattaacgatagagacgtaaaacttctgaataaagaaggaatgctttccaattat
gctgcaacacataatattgggaaattgggtatcgaacgctattatgaaagcacactacat
ggtaaagctggttataaagaaatagaggttaataatcgaggtcgagtaatccgtcaatta
tatgagcgattacctcaagcaggaaaagatattattctgacactgcatctaagtttgcaa
cgatatatcgagacattattaattggaacccgttcagcagttgtcgtttttgatcctcga
gatggcggaatcctcgcactggtatccaatccgagttacgatcctaatatgtttgttaac
ggtatttctgcaaagaaataccacgcgttactagaggataaaaactatccacttataaat
cgtactactcaaggtatttatccacccgcctctaccgtaaaaccttatatttcagtatca
gcgctcacacttggcattattaatgaaaacttttctttatttgatccaggctggtggcaa
ttacccgattcaaagaagcgttatcgtgattggaaacgatgggggcatggtcaattaaat
attacccgagcactagaagagtcatcggatacttttttttatcaagtagtatacaatatg
ggtattgaccgactttccgaatggatgaaaaaatttggctacggccagtatactggtatt
gatttagccgaagaatactctggagtaatgccgactcgtgagtggaaatttgcgcgtttt
aaaaaaccctggtatcagggggatactattcctgttgcaattggtcaaggttactggacc
gcaacaccgttacaaatgtcaaaggcaatgatgacactaattaatgatggtacagtacaa
attccacatctactctacggtatacaagaaaacgactatcaaattccttatcgtcaacca
aaaaatattcaaataggtgatccgaattctggattctgggaaatagttaaagatggtatg
tttggtgtcgctaaccgaccaaacggtacagcatgtaaaagcttttctgatgcgccttat
aaagcagctgttaaatctggtactgctcaggtatatgggctaaaaactaatgaaatttac
aatgcaaataaaatcgctgaacacctgcgcgatcataaactgatgactgcatttgcccct
tataataaaccgacagtaggcgttgttgttattctagaaaatggcggtgtcggtccaaca
gcaggagaaattactcgacagattttagattatatccttctaaaggatgatactgtggat
ttttctttaaaaacttcacgccaagctaaatag

DBGET integrated database retrieval system