KEGG   Geminocystis sp. NIES-3708: GM3708_1202Help
Entry
GM3708_1202       CDS       T04168                                 

Definition
(GenBank) aspartyl-tRNA(Asn) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gee  Geminocystis sp. NIES-3708
Pathway
gee00970  Aminoacyl-tRNA biosynthesis
gee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gee00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GM3708_1202
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gee03029]
    GM3708_1202
Enzymes [BR:gee01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GM3708_1202
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GM3708_1202
Mitochondrial biogenesis [BR:gee03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GM3708_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAQ60796
UniProt: A0A0D6ADA2
LinkDB All DBs
Position
1353879..1355366
Genome map
AA seq 495 aa AA seqDB search
MTTANQTKYEAIIGLETHCQLNTNTKIFCNCSTHFDSPPNTNVCPVCLGHPGVLPVLNEE
VLNSAIKMGLAIEGDIARYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGKLEIELVDSKT
KEVRKKTIGITRLHMEEDAGKLVHAGSDRLAGSTHSLVDFNRTGIPLLEIVSEPDLRSGQ
EASEYAQELRRVVRYLGIGDGNMQEGSLRCDVNISVRPLGQKEFGVKVEIKNMNSFSAIQ
KAIEYEIERQIEAINNGESIIQETRLWEEGTQKTISMRVKEGSSDYRYFPEPDLPPMEVS
EVQLEELRKLLPELPAKKRSRYEAEFGLSAYDARILADDRDVALYFETVVAGGVSVKAAA
NWITQDIAAYLNSNVGITIKDIALKPENLADLITLIENGTISGKIAKDLLPELLVKGGSP
KEIVESKGLIAISNPDELAQIIDKIITANPDKLEQFRAGKTKLQGFFVGQIMKETGGKAD
PKLANKILNEKLNNN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagctaatcaaaccaagtatgaagcgattattggtttagaaactcattgtcaa
cttaatactaatacaaaaattttctgtaattgttctactcattttgacagtcctcctaat
actaatgtttgccctgtgtgtttaggacatccgggggttttacctgtattaaacgaggag
gtgttaaactctgccatcaaaatgggtttagctattgaaggagacattgctcgttatagt
aaattcgatcgcaaacaatatttttatcctgatttacccaaaaattaccaaatatctcag
tttgatttacctatcgttgaacatggtaaattggaaattgaattagtcgattctaaaacc
aaagaagtgcgtaaaaaaaccatcggtatcacccgtttacacatggaagaagacgcagga
aaattagttcatgctggaagtgatcgtttagctggatcaactcattctttggtagatttt
aataggactggtattcctttattagaaattgtatcagaaccggacttacgtagtggacaa
gaagcctctgagtatgctcaagaactgcgtcgtgtggtgcgttatttaggtatcggtgac
ggtaatatgcaagaaggatcattacgttgtgatgttaacatttccgtgcgtcctcttggt
caaaaagaatttggtgtgaaggttgaaatcaaaaatatgaactcctttagtgccattcaa
aaagcgattgaatatgagattgaaagacaaatagaagctattaataatggtgaatctatt
attcaagaaactcgtttgtgggaagaaggtactcaaaaaactattagtatgagagtcaaa
gaaggctcaagcgattatcgttatttccctgagccagatttaccacccatggaagttagt
gaagtgcagttagaagagctaagaaaattattaccagaattaccagctaaaaaacgtagt
cgttacgaagcagaatttggcttatcagcttatgatgctagaattttagccgatgataga
gatgtagcgttgtattttgaaactgttgtcgctggtggtgtaagtgtcaaagcggcggct
aactggataacgcaggatattgccgcttatttgaatagtaatgttggtattaccatcaaa
gatattgctttaaaacccgagaatttagcggatttaattactttaattgaaaatggtaca
attagcggtaaaattgctaaagatttattaccagaattattagttaaaggtggatctcct
aaagaaatagtcgaaagtaaaggcttaattgctatatctaatcctgatgaattagcacaa
attattgataaaattatcactgctaaccctgataaattagaacaatttagagcgggaaaa
actaaattacaagggttttttgtggggcaaattatgaaggaaacaggagggaaagcagat
ccgaaattagcaaataaaattctcaatgaaaaattaaacaataactaa

DBGET integrated database retrieval system