KEGG   Geminocystis sp. NIES-3708: GM3708_1441Help
Entry
GM3708_1441       CDS       T04168                                 

Definition
(GenBank) restriction endonuclease R.XbaI
Organism
gee  Geminocystis sp. NIES-3708
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI
Motif
Other DBs
NCBI-ProteinID: BAQ61035
UniProt: A0A0D6AE65
LinkDB All DBs
Position
complement(1602139..1602474)
Genome map
AA seq 111 aa AA seqDB search
MKNDDTSHYLIYRVLGITSQEGQKIDEYQNIGRFLYNYAGSFLKEIASLCLLFNNPQGKK
TTVKNSFGTKPKTFEIDFLDGNDAIEIKWRDATTDRDHNHERAYSCKSYTK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgatgatacttctcattatctaatttatagagttttggggataaccagccaa
gaagggcaaaaaatagacgaatatcaaaatattggtaggtttttatataattatgctggt
tcttttttaaaagaaattgcttctttatgtttattatttaacaatcctcaaggaaaaaaa
actactgttaaaaattcttttggtacaaaaccgaaaacctttgaaattgattttttagat
ggcaatgatgctattgagattaaatggagagatgccactacagacagagaccataatcac
gaaagagcatactcatgtaaaagctatacaaaatag

DBGET integrated database retrieval system