KEGG   Geminocystis sp. NIES-3708: GM3708_758Help
Entry
GM3708_758        CDS       T04168                                 

Definition
(GenBank) bicarbonate transport system permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
gee  Geminocystis sp. NIES-3708
Pathway
gee00910  Nitrogen metabolism
gee02010  ABC transporters
Module
gee_M00438  Nitrate/nitrite transport system
gee_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:gee00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    GM3708_758
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GM3708_758
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gee02000]
    GM3708_758
Transporters [BR:gee02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    GM3708_758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAQ60352
UniProt: A0A0D6AC52
LinkDB All DBs
Position
complement(838300..839136)
Genome map
AA seq 278 aa AA seqDB search
MISRTQKTSTSSNFFNSIFYSQNTRKIIAPLIALFVLLAIWQILSSGENPNLPSPTTVIK
ETWDPYIINPFFHNGGTDVGLFWQLLASLKRVAIGFSLATVVGIALGILIGANRVIYSAL
DPIFQVLRTIPPLAWLPISLAALRQADPSAIFVIFITAIWPIIINTTVGVQQIPQDYNNV
SRVLKLSKIEYFFNILFPSTVPYIFTGLKIGIGLSWLAIIAAEMLVGGVGIGFFIWDAYN
SSEMSQIIIALFYVGIIGLLLDRVVGFIGTLVVPQEPK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaagaactcaaaaaacatcaacaagtagtaatttttttaactctattttttat
tctcaaaatacgagaaaaataattgctcctctcattgctttgttcgtattattagcaatt
tggcaaattttatcttcaggagaaaatcctaacttaccttctccgacaactgtaattaaa
gaaacatgggatccttacatcatcaatcctttttttcataatggtggtacggatgttggt
ttattttggcaacttttagctagtttaaaaagagttgccattggattttccttagcgacg
gtagttggtattgcattaggaattttaattggtgcaaatcgtgttatttattctgctcta
gatccgatttttcaggtactaagaactattccacctttagcatggttacctatttctcta
gcggctttaagacaggctgatccttccgcaattttcgttatttttattacagctatttgg
cctattatcattaataccactgtaggtgtacaacaaataccacaagactataataacgtt
tctagagtacttaaattatcaaaaattgaatacttttttaatatcttattcccttccact
gttccttatattttcacaggtttaaaaataggtattggtttatcttggttagcaattatt
gccgctgaaatgttagtaggtggtgttggtattggtttctttatttgggatgcttataac
agctcagaaatgagccaaattattattgctttattctatgtgggtatcatcggtttatta
ctagatagagtagttggttttattggtactttagtcgttccacaagagccaaaataa

DBGET integrated database retrieval system