KEGG   Geminocystis sp. NIES-3708: GM3708_894Help
Entry
GM3708_894        CDS       T04168                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gee  Geminocystis sp. NIES-3708
Pathway
gee00010  Glycolysis / Gluconeogenesis
gee00020  Citrate cycle (TCA cycle)
gee00620  Pyruvate metabolism
gee01100  Metabolic pathways
gee01110  Biosynthesis of secondary metabolites
gee01120  Microbial metabolism in diverse environments
gee01130  Biosynthesis of antibiotics
gee01200  Carbon metabolism
Module
gee_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM3708_894
   00020 Citrate cycle (TCA cycle)
    GM3708_894
   00620 Pyruvate metabolism
    GM3708_894
Enzymes [BR:gee01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GM3708_894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase DUF1298
Motif
Other DBs
NCBI-ProteinID: BAQ60488
UniProt: A0A0D6ACJ5
LinkDB All DBs
Position
complement(1004876..1006138)
Genome map
AA seq 420 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWEKAPGDKIEKGETVVVVESDKADMDVESFYSGYLATIL
VPAGEEAPVGQAIAYIAETEAEIEEAKQKASQGQQATPAPQNEVKAEPDPIVTATVNTTA
KTNGRIVVSPRAKKLAKEFKVDLSNIVGTGLNGRIIAEDVEKLAGKVPQTPKVSPVIATV
TATPSIAPAPIPVNNLAGQTIPFNTLQQAVIRNMMASLQVPTFQVSYSINTDQLDSLYRK
IKSKGVTMTALLAKAVAVTLQKHPVVNASFSEAGIKYNESINIAVAVAMPDGGLITPVIK
NADQIDIYSLARNWQDLVNRARAKQLQPDEYTTGTFTLSNLGMFGVSNFTAILPPGLGSI
LAIGGASPTVVANGDGLFGVKNQMSVNITCDHRIIYGADAAAFLQDLAKLIETDVQSLTL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatatttttatgcctgcccttagttcaacaatgacagaagggaagatcgtt
tcatgggaaaaagcaccaggagataaaattgaaaaaggagaaaccgttgttgtcgtggaa
tcagacaaagcggatatggatgtagaatccttttattctggttatttagctactatttta
gtcccagcgggggaagaagccccagtcggacaggcgatcgcttatattgctgaaacagaa
gcagaaatagaagaagccaaacaaaaagctagtcaaggtcaacaagctactcctgcacct
caaaacgaagtcaaagctgaacctgaccccattgttactgctactgttaacactacagct
aaaactaatggtagaattgtcgtctctcctagagccaaaaaattagctaaagaatttaaa
gttgatttaagtaatattgttggtactggtcttaatggacgtattattgcggaagatgtg
gaaaaattagctggaaaagttcctcaaacaccgaaagttagtcctgttattgccactgtt
actgctacacccagtattgctccagcacctattccagttaataatttagcagggcaaact
ataccttttaacactttacaacaggctgtcatacgaaatatgatggctagtttacaagta
cccacctttcaagttagttatagtattaacaccgatcaattagatagtctttatcgtaaa
attaaatcgaaaggggtaacaatgactgctttattagcgaaagctgtagctgttacttta
caaaaacatcctgttgttaatgctagtttcagtgaagcaggtattaagtataacgaaagt
attaatattgccgtagccgtagctatgcctgatggtggtttaattactcctgttattaaa
aatgccgatcaaattgatatttattccttagcacgtaattggcaagatttggttaaccgt
gctcgtgcaaaacagttacaaccagatgaatataccacgggcacttttaccctatctaat
ttaggtatgtttggtgttagtaatttcaccgccattttgcctcccggattaggctcaatt
ctcgccatcggtggtgcttctcctacggttgtagccaatggtgacgggttatttggtgtt
aaaaatcaaatgtcagtaaatatcacctgtgatcaccgaattatttatggtgcggatgcg
gcagcatttttacaagatttagcgaaattaattgaaactgatgttcaatctttaactcta
taa

DBGET integrated database retrieval system