KEGG   Geminocystis sp. NIES-3708: GM3708_894
Entry
GM3708_894        CDS       T04168                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gee  Geminocystis sp. NIES-3708
Pathway
gee00010  Glycolysis / Gluconeogenesis
gee00020  Citrate cycle (TCA cycle)
gee00620  Pyruvate metabolism
gee01100  Metabolic pathways
gee01110  Biosynthesis of secondary metabolites
gee01120  Microbial metabolism in diverse environments
gee01200  Carbon metabolism
Module
gee_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM3708_894
   00020 Citrate cycle (TCA cycle)
    GM3708_894
   00620 Pyruvate metabolism
    GM3708_894
Enzymes [BR:gee01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GM3708_894
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase WS_DGAT_C
Other DBs
NCBI-ProteinID: BAQ60488
UniProt: A0A0D6ACJ5
LinkDB
Position
complement(1004876..1006138)
AA seq 420 aa
MIHDIFMPALSSTMTEGKIVSWEKAPGDKIEKGETVVVVESDKADMDVESFYSGYLATIL
VPAGEEAPVGQAIAYIAETEAEIEEAKQKASQGQQATPAPQNEVKAEPDPIVTATVNTTA
KTNGRIVVSPRAKKLAKEFKVDLSNIVGTGLNGRIIAEDVEKLAGKVPQTPKVSPVIATV
TATPSIAPAPIPVNNLAGQTIPFNTLQQAVIRNMMASLQVPTFQVSYSINTDQLDSLYRK
IKSKGVTMTALLAKAVAVTLQKHPVVNASFSEAGIKYNESINIAVAVAMPDGGLITPVIK
NADQIDIYSLARNWQDLVNRARAKQLQPDEYTTGTFTLSNLGMFGVSNFTAILPPGLGSI
LAIGGASPTVVANGDGLFGVKNQMSVNITCDHRIIYGADAAAFLQDLAKLIETDVQSLTL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgattcacgatatttttatgcctgcccttagttcaacaatgacagaagggaagatcgtt
tcatgggaaaaagcaccaggagataaaattgaaaaaggagaaaccgttgttgtcgtggaa
tcagacaaagcggatatggatgtagaatccttttattctggttatttagctactatttta
gtcccagcgggggaagaagccccagtcggacaggcgatcgcttatattgctgaaacagaa
gcagaaatagaagaagccaaacaaaaagctagtcaaggtcaacaagctactcctgcacct
caaaacgaagtcaaagctgaacctgaccccattgttactgctactgttaacactacagct
aaaactaatggtagaattgtcgtctctcctagagccaaaaaattagctaaagaatttaaa
gttgatttaagtaatattgttggtactggtcttaatggacgtattattgcggaagatgtg
gaaaaattagctggaaaagttcctcaaacaccgaaagttagtcctgttattgccactgtt
actgctacacccagtattgctccagcacctattccagttaataatttagcagggcaaact
ataccttttaacactttacaacaggctgtcatacgaaatatgatggctagtttacaagta
cccacctttcaagttagttatagtattaacaccgatcaattagatagtctttatcgtaaa
attaaatcgaaaggggtaacaatgactgctttattagcgaaagctgtagctgttacttta
caaaaacatcctgttgttaatgctagtttcagtgaagcaggtattaagtataacgaaagt
attaatattgccgtagccgtagctatgcctgatggtggtttaattactcctgttattaaa
aatgccgatcaaattgatatttattccttagcacgtaattggcaagatttggttaaccgt
gctcgtgcaaaacagttacaaccagatgaatataccacgggcacttttaccctatctaat
ttaggtatgtttggtgttagtaatttcaccgccattttgcctcccggattaggctcaatt
ctcgccatcggtggtgcttctcctacggttgtagccaatggtgacgggttatttggtgtt
aaaaatcaaatgtcagtaaatatcacctgtgatcaccgaattatttatggtgcggatgcg
gcagcatttttacaagatttagcgaaattaattgaaactgatgttcaatctttaactcta
taa

DBGET integrated database retrieval system