KEGG   Gemmobacter sp. HYN0069: HYN69_01705Help
Entry
HYN69_01705       CDS       T05407                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
geh  Gemmobacter sp. HYN0069
Pathway
geh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:geh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HYN69_01705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:geh02000]
    HYN69_01705
Enzymes [BR:geh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HYN69_01705
Transporters [BR:geh02000]
 Other Transporters
  Pores ion channels [TC:1]
   HYN69_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 Tom37 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AWB47392
UniProt: A0A2S0UHU2
LinkDB All DBs
Position
365130..365747
Genome map
AA seq 205 aa AA seqDB search
MTLTLYTHPMSRGRMARWMLEELGQPYDAVYLDYATTMKTPDYLAINPMGKVPALVHDGR
VVTECAAIVTYLADAFPDAGLMPADRAAFYRWMFFGAGPFESAVTNKALGVEVPPEKRGF
VGYGSFDRLLATLDATLSARDFLAGDRFSAVDLYVGSQIGYGLMFGSLPASAALSAYWDR
IKDRPARLRAAGLDDAELARMKHDG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgacgctttacacccatccgatgtcacgcggccgcatggcccgctggatgctg
gaagaactgggccagccctatgatgcggtttacctcgactatgcgaccacgatgaaaacg
cccgactatctggcgatcaacccgatgggcaaggtgcccgcgctggtgcatgacggccgc
gtggtaacggaatgtgcggccatcgtcacctatctggccgatgcctttcccgacgcgggg
cttatgcctgccgaccgcgccgccttttaccgctggatgttcttcggggccggccccttt
gagtcggcggtcacgaacaaggcgctgggggtcgaggtgccgccggaaaagcggggcttc
gtcggctatggcagtttcgatcggctgttggcaacgctcgacgccacgctttcggcgcgt
gactttctggccggagacaggttttcggcggttgacctctatgtcggctcgcagatcggc
tacgggctgatgttcggctcgcttcccgcaagcgccgccctgtccgcctattgggaccgg
atcaaggaccgccccgcccgcctgcgcgccgcaggtctcgatgatgccgaactggcaagg
atgaaacacgatggctga

DBGET integrated database retrieval system