KEGG   Gemmobacter sp. HYN0069: HYN69_06015Help
Entry
HYN69_06015       CDS       T05407                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
geh  Gemmobacter sp. HYN0069
Pathway
geh00040  Pentose and glucuronate interconversions
geh00051  Fructose and mannose metabolism
geh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HYN69_06015
   00051 Fructose and mannose metabolism
    HYN69_06015
Enzymes [BR:geh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     HYN69_06015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AWB48132
UniProt: A0A2S0UJZ9
LinkDB All DBs
Position
1238458..1239453
Genome map
AA seq 331 aa AA seqDB search
MLGSRFATRINSFASAAHGYWPGQVEKPSLAQMIARAATVPGLTELDLNYPDHVGAKPAE
VAAMVAGCGLAISGLAMRYYTNPAFKRGAFTNPDRAVRREAIDLTKRGIDAARAMGAPMM
TLWLGQDGFDYAFQCDYQRLWADEVEGIAEVAAHDPDCLVSIEYKPNEPRSYSLLRDAAT
TLLAIDEAGADNLGVTIDFAHALYADEQPANAAAMVMRRSRLLGLHLNDGYAKRDDGLMV
GAVHGQATLELLAEVKRGGFDGAIYFDTFPDASGLDPVAECAANIRTVRRMLAAVGRMEG
DNRLADAKARHDPVTAQEIAQLALSGDISTG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcttggatcgcgctttgccacccgtatcaattccttcgcttcggcggcgcatggctat
tggccggggcaggtggaaaagccttcgctggcgcagatgattgcgcgggccgcgacggtt
ccgggcttgaccgagcttgatctgaactatcccgaccatgtgggggcgaagcctgccgaa
gtggcggcgatggtggccggttgcgggctggcgatcagcgggctggcgatgcgctactat
accaatccggccttcaagcggggggcgttcaccaaccccgaccgcgcggttcggcgcgag
gcgatcgatctgaccaagcgcgggatcgatgcggcacgggcgatgggcgcgccgatgatg
acgctgtggctggggcaggacgggttcgattacgcctttcaatgcgactatcaaaggttg
tgggccgacgaggtggagggcatcgccgaggtggcggcacatgatccggactgtctggtg
tcgatcgagtacaagcccaacgagccgaggagttacagcctgttgcgcgatgcggcgacg
acgcttctggccatcgacgaggcgggggcggacaacctgggcgtgaccatcgatttcgcc
catgcgctttatgccgacgagcagcctgccaatgcggcggcgatggtgatgcggcggtcg
cgcctgttggggctgcacctgaacgacggctatgccaagcgggatgacggcttgatggtg
ggggccgtgcacgggcaggccacgctggaactgctggccgaggtcaagcgcggcgggttc
gacggggcgatctatttcgacacgtttccagatgcatcggggttagaccccgtggccgaa
tgtgcggccaacatccgcaccgtgcggcggatgctggcggcggtcgggcggatggagggg
gataaccggctggccgacgccaaggcgcgccatgatccggtgacggcgcaagagatcgcg
caactggccttgtcgggggatatatcgacggggtga

DBGET integrated database retrieval system