KEGG   Gemmobacter sp. HYN0069: HYN69_07255Help
Entry
HYN69_07255       CDS       T05407                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
geh  Gemmobacter sp. HYN0069
Pathway
geh00970  Aminoacyl-tRNA biosynthesis
geh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HYN69_07255 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:geh03029]
    HYN69_07255 (gatB)
Enzymes [BR:geh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HYN69_07255 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HYN69_07255 (gatB)
Mitochondrial biogenesis [BR:geh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HYN69_07255 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AWB48339
UniProt: A0A2S0UKJ4
LinkDB All DBs
Position
1514090..1515601
Genome map
AA seq 503 aa AA seqDB search
MLDLSYQTPKPKVIAGATGDWELVIGMEIHAQVASNAKLFSGASTQVGSEPNSNVAFVDA
AMPGMLPVINAYCIEQAVRSGLGLKAHINLTSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEVLVDMGAGIARLVRIERIHLEQDAGKSIHDMDPTMSFVDFNRTGVALMEIVSRPDIRG
PEEAAAYVSKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQATQDFGHLGTRC
EIKNMNSLRFIQQAIDHEARRQIAILEDGGKVMQETRLYDPDKGETRSMRSKEEAHDYRY
FPCPDLLPLEIEQAWVDDIAASMPELPDAKKARFMADFGLTDYDANVLTAELESAGFFEA
VAQGRDGKTSANWVINELFGRLNKEGKAIADSPVSAAQLGGMLDLLASGEITGKMAKDLF
ELIWTEGGDPAEVAAKHGMKAVTDTGAIEEALDQLIEANPAQVEKAKVNAKLAGWFTGQV
LKATGGKADPAVVNAMVAQKLGL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatctttcctatcagacccccaaacccaaagtgatcgcgggcgcgaccggcgat
tgggaactggtgatcggcatggaaatccatgctcaggtcgcctcgaacgccaagttgttc
tcgggcgcgtccacgcaagtggggtctgaacccaattcgaacgtggccttcgtcgacgca
gccatgcccggcatgctgcccgtcataaacgcatattgcatcgaacaggcggtgcgctcg
ggtcttggcctgaaagcgcatatcaacctgacgagcgcctttgaccgcaagaactacttc
taccccgacctgccgcagggctaccagatcagccagctttaccaccccatcgtgggcgag
ggcgaagtgctggtcgacatgggcgcgggcatcgcgcgtctggtgcggatcgaacgcatc
caccttgaacaggatgcgggaaaatcgattcatgacatggacccgaccatgtcctttgtc
gatttcaaccgtaccggcgtggcgttgatggagatcgtcagccgccccgacatccgcggc
cccgaagaagccgcggcctatgtgtcgaaactgcgccagatcctgcgttaccttggcacc
tgcgatggcaacatgcagaacggcaacctgcgagccgatgtgaacgtgtcggtctgccgt
ccggggcagtatgagaaatatcaggccacgcaagactttggccacctcggcacgcgctgc
gagatcaagaacatgaactcgctgcgcttcatccagcaggcgatcgaccatgaggcccgc
cgccagatcgccattctggaagatggcggcaaggtgatgcaggaaacccggctttatgac
cccgacaagggcgagacgcggtcgatgcggtccaaggaagaagcccatgattaccgctac
ttcccctgtcccgacctgctgccgctggaaatcgaacaggcctgggtcgatgacatcgcg
gcgtcgatgcccgaactgccagacgccaaaaaggcccgcttcatggctgatttcggcctg
accgattacgatgccaacgtgctgaccgccgaactcgaatccgccggtttcttcgaggcc
gtggcacaggggcgtgatggcaaaacctcggctaactgggtcatcaacgagcttttcggt
cgcttgaacaaagagggcaaggcaatcgcagacagccccgtgtcggcagcgcagcttggc
ggaatgctcgatcttctggccagtggcgagatcaccggcaagatggccaaggaccttttc
gaacttatctggacggaaggcggcgaccccgccgaagtggccgcaaagcatggcatgaag
gccgtgaccgataccggagcgatcgaagaggcgctggaccagctgatcgaagccaacccc
gcgcaggtggaaaaggccaaggtcaacgccaagctggcaggctggttcaccggacaggtg
ttgaaggcaaccggcggcaaggccgatccggcggtcgtcaatgccatggtcgcgcagaaa
ttgggactctga

DBGET integrated database retrieval system