KEGG   Gemmobacter sp. HYN0069: HYN69_12775Help
Entry
HYN69_12775       CDS       T05407                                 

Definition
(GenBank) NADH-specific enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
geh  Gemmobacter sp. HYN0069
Pathway
geh00061  Fatty acid biosynthesis
geh00780  Biotin metabolism
geh01100  Metabolic pathways
geh01130  Biosynthesis of antibiotics
geh01212  Fatty acid metabolism
Module
geh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:geh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HYN69_12775
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HYN69_12775
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HYN69_12775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:geh01004]
    HYN69_12775
Enzymes [BR:geh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HYN69_12775
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HYN69_12775
Lipid biosynthesis proteins [BR:geh01004]
 Fatty acid synthase
  Component type
   HYN69_12775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AWB49265
UniProt: A0A2S0UN94
LinkDB All DBs
Position
2648552..2649352
Genome map
AA seq 266 aa AA seqDB search
MADLMKGKRGLVMGVANERSIAWGIARAMAAEGAELAFSYQGDAFGKRLAPLAASVGSDF
MVDVDVTDDASLDACFAALAERWGTIDFVVHAIAYSDKNELTGRFSNTSRANFTNSLAIS
CFSFIDISRRAAELMPAGGTLITLTYGGSNRVTPNYNVMGVAKAALESSVRYLANDLGPQ
QIRVNAVSPGPMKTLAGAAIGGARATYRHTEANAPLRANATLEAVGGTAVWLASDYGACT
TGEIIHVDGGYHVLGMPQPESGADKA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggccgatctgatgaagggcaagcgcgggcttgtcatgggcgtggcgaacgaacgctcg
atcgcatggggcatcgcccgcgccatggccgccgaaggcgccgaactcgccttctcctat
cagggtgacgctttcggcaaacgccttgccccgctcgcggcctcggtcggatcagatttc
atggtcgatgtcgacgtgaccgacgacgcctcgctcgacgcctgcttcgccgcactggca
gagcgttggggcaccatagacttcgtggtccatgccatcgcctattccgacaagaacgaa
ctcaccggccgcttctcgaacacctcgcgcgcgaacttcaccaattccttggcgatctcg
tgcttctccttcatcgacatctcgcgccgcgcggccgagctgatgcccgcaggcggtacg
ctgatcaccctcacctacggcggctcgaaccgcgtcacgccgaactacaacgtgatgggc
gtggccaaagcggcgctggaatcctcggtccgctacctcgccaatgacctcggcccgcaa
cagatccgcgtcaacgccgtatcgccggggccgatgaagacactggcaggggccgccatc
ggcggtgcgcgcgccacctaccgccacaccgaagccaacgccccccttcgcgccaatgcc
accctcgaagccgtaggcggcacagccgtctggctcgcgtcggactacggtgcctgcacg
accggagagatcatccacgtcgacggcggctaccacgtcctcggcatgccgcaaccagaa
tcgggcgccgacaaggcctga

DBGET integrated database retrieval system