KEGG   Gemmobacter sp. HYN0069: HYN69_12905Help
Entry
HYN69_12905       CDS       T05407                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
geh  Gemmobacter sp. HYN0069
Pathway
geh00240  Pyrimidine metabolism
geh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    HYN69_12905
Enzymes [BR:geh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HYN69_12905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14
Motif
Other DBs
NCBI-ProteinID: AWB49287
UniProt: A0A2S0UNB0
LinkDB All DBs
Position
2678081..2678671
Genome map
AA seq 196 aa AA seqDB search
MAKLYFHYSTMNAGKSTLLLQAAHNYREGGMATYLVTAQFDNRAGQGRIASRIGIGEDAD
TFAPGEDLYAKIVARLRQGPVACVFIDEAQFLSKDQVWQLARAVDDLKTPVMCYGLRVDF
QGNLFPGSAALLAWADEMREVRTICHCGKKATMVIRRGPDGRALTAGEQVVIGGNETYVS
LCRKHWREATGDTSGG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctacttccactactcgacgatgaacgcaggcaaatcgaccctgctcctc
caggccgcgcataactaccgcgaaggcggcatggcgacctatctcgtcaccgcgcaattc
gacaaccgcgcaggccaaggtcgcatcgcctcacgtatcggcatcggcgaagacgccgac
accttcgcccccggcgaggacctctacgccaagatcgtcgcccgcttgcgccaaggcccc
gtcgcctgcgtcttcatagacgaggcgcaattcctgtccaaagaccaggtctggcaactc
gcccgcgccgtcgacgacctcaagacgccggtgatgtgctacggcctgcgcgtcgatttc
cagggcaacctcttccccggctcggcggccctgctggcatgggcggatgaaatgcgcgag
gtccgaacgatctgccactgcggcaagaaggccaccatggtcatccgccgcggccccgac
ggccgcgcgctcacggcaggcgaacaggtggtgatcggcgggaacgaaacctatgtcagc
ctctgccgcaaacactggcgcgaagcgaccggcgacaccagcggtgggtga

DBGET integrated database retrieval system