KEGG   Geitlerinema sp. PCC 7407: GEI7407_0676Help
Entry
GEI7407_0676      CDS       T02366                                 

Definition
(GenBank) glycosyl transferase family 2
  KO
K19003  1,2-diacylglycerol 3-beta-glucosyltransferase [EC:2.4.1.336]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00561  Glycerolipid metabolism
gei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    GEI7407_0676
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gei01003]
    GEI7407_0676
Enzymes [BR:gei01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.336  monoglucosyldiacylglycerol synthase
     GEI7407_0676
Glycosyltransferases [BR:gei01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   GEI7407_0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21 Glyco_tranf_2_4 Glyco_tranf_2_2
Motif
Other DBs
NCBI-ProteinID: AFY65174
UniProt: K9S5Y0
LinkDB All DBs
Position
complement(821186..822628)
Genome map
AA seq 480 aa AA seqDB search
MPENSWPENGSSSELNSVNTLFTDWSPEDFEGNYNPSSAGRRRKAAVTLAVVWSITVALH
WLSWGSWVVWGLTLVTGIHALRVLAARPGALPEPLSAQIKPESLPYVSLLVAAKNEEGVV
TRLVRHLCSLDYPASRYDLWVINDNSADRTGALLDELARSHPQLKVIHRGAEASGGKSGA
LNQAWPQTRGDVVAVFDADAQVPKDLLRRVLPMFERPKVGAVQVRKAIANATANFWTRGQ
AAEMALDTFFQQQRIALGGIGELRGNGQFIRRQALQSCGGFNEETITDDLDLTVRLHLES
WDLESLSYPAVEEEGVTGPVALWHQRNRWAEGGYQRYLDYWRPLVWNRLGFNKTLDLLMF
WLIQYILPTAALPDLTLAIARHTSPVLAPLTGMTVGLSLMGMYVGLRRIQRQQASISPLW
RSRLRAAGQTLLGTVYMFHWLVVIGSTTVRMSIRPKRLKWVKTVHYGAQEEWADAPGGVS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaattcctggccagaaaacggttcctccagcgagcttaattcggtcaatacg
ctttttacagactggtctcccgaagactttgagggaaactacaaccccagctccgcaggg
cgtcgtcgcaaggcggcggtgaccctggcggtggtgtggagcatcacggtggcgctccac
tggctgtcttggggatcttgggtggtgtgggggctgaccctggtgacggggatccacgcg
ctgcgggtcctggcagctcggcccggcgctttgccggagccgctgtcggcccagatcaaa
cccgagtctttgccctacgtttcgctgctggtggcggccaagaacgaggaaggcgtggtg
acccgactcgtccgtcacttgtgcagcctggactatccggcatcgcgctacgacctctgg
gtgatcaatgacaacagcgccgatcgcacaggtgcgctgctagacgagcttgctcggtcc
catcctcagctcaaggtgattcaccggggggcggaggcgagcggcggcaagtctggggcg
ctcaatcaggcctggccccagacgcggggcgacgtggtggcggtctttgacgcggatgct
caggtgccgaaggatttgctgcgccgggtgttgccgatgtttgagcggccgaaggtggga
gcggtgcaagtgcgcaaggcgatcgccaacgccacggccaatttttggacgcggggtcaa
gccgcagagatggccctggacaccttctttcagcaacagcgcattgccctgggcggcatc
ggtgagctgcggggcaacggccagtttattcgccgccaagccctccaaagctgcggcggc
ttcaatgaagagaccatcacagatgacctcgatttgacggtgcgactgcacctggagagc
tgggatctcgagtccttgagctatccagcggtggaagaggaaggcgtaaccggtcccgtg
gctctctggcatcagcgcaaccggtgggcagagggcggctatcagcgctatctggactac
tggcgaccgctggtctggaaccgactgggctttaacaaaacgctggatttgctgatgttc
tggctgatccagtacatcttgccaacggcggcgctgccggatttgacgttggcgatcgcc
cgccacaccagtcctgtgctggcgcctctgaccgggatgaccgtggggctgtcgctgatg
ggcatgtacgtaggcctgcggcgaattcagcgtcagcaggcgtcgatctctcctctgtgg
cgatcgcgcctcagggccgctggacagacgctgctcggtacggtgtacatgttccactgg
ctcgtggtgattggcagcacgaccgtgcgcatgtctatccggcccaagcgtctcaaatgg
gtcaaaacagtccactacggcgctcaagaagaatgggccgatgcgcctgggggcgtttcc
tag

DBGET integrated database retrieval system