KEGG   Geitlerinema sp. PCC 7407: GEI7407_1183Help
Entry
GEI7407_1183      CDS       T02366                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00010  Glycolysis / Gluconeogenesis
gei00020  Citrate cycle (TCA cycle)
gei00620  Pyruvate metabolism
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
gei01120  Microbial metabolism in diverse environments
gei01130  Biosynthesis of antibiotics
gei01200  Carbon metabolism
Module
gei_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEI7407_1183
   00020 Citrate cycle (TCA cycle)
    GEI7407_1183
   00620 Pyruvate metabolism
    GEI7407_1183
Enzymes [BR:gei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GEI7407_1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AFY65680
UniProt: K9S690
LinkDB All DBs
Position
1413108..1414400
Genome map
AA seq 430 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLATII
VDAGGSAPVGNAIALIAETEAEIEQAQQRASTQSAPAAAPAAPAPSAAAPAAEAPSAASN
GASASPAAREGRLIVSPRARKLAKELKVDLSTLRGSGPHGRIVAEDVEAAAGRPASAPTV
QAASLTAAAPVVASAPAAAAPAPAPVVPGEVTPFNTLQKAVVQGMVASLQVPVFRVSYSI
GTDKLDQLYKQVKSKGVTMSALLAKAVALTLQKHPLLYAAYTDQGTHYNSAINVAVAVAM
DDGGLITPVLQNADQVDLYSLSRTWKDLVQRARVKQLQPQEYNSGTFTISNLGMFGVDTF
DAILPPGQGSILAIGAAKSQVVATGNGFSIQKQMQVNITCDHRIIYGAHAAAFLKDLADL
IENNTHSLTL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgaagttttcatgcccgctctgagctccacgatgaccgaggggaaaatcgtt
tcctgggtcaaatcgccgggtgacaaggtggaaaaaggtgaaaccgtcgttgtcgtggaa
tccgacaaggccgatatggacgtcgagtccttctacgaaggctacctggccaccatcatc
gtggatgcgggcggctccgcaccggtcggaaacgcgatcgccctgattgctgagaccgaa
gccgaaatcgagcaggcccagcagcgcgccagcacccagagcgcccctgccgctgcaccc
gccgcgcccgccccgtctgctgccgcccctgccgccgaagctcccagcgccgccagcaac
ggcgcctcggctagccccgccgcccgcgaaggccgcctcattgtctcgcctcgcgcccgc
aagcttgccaaagaactgaaagttgacctgtctactctgcgcggcagcggcccccacggc
cgcatcgtcgccgaagacgtcgaagcggccgctggacgtcccgccagcgcgccgaccgtc
caggctgccagccttactgcggctgcgccggtcgtcgccagcgcgcccgctgctgcggct
cccgctccggccccagtggtccccggcgaagtcacccccttcaacaccctccagaaggct
gtggtccagggcatggtggccagcctccaggttcctgttttccgggtcagctacagcatc
ggcaccgacaagctcgaccagctctacaagcaggtgaagtccaagggcgtgacgatgtct
gccctgctggccaaggccgtcgctctgaccctgcaaaagcatcccctgctctacgccgcc
tacacggatcaaggcacgcactacaacagcgccatcaacgtggcggtggcggtggccatg
gacgacggcggcctgatcaccccggtcctgcaaaacgctgaccaggtggatctctactcc
ctctcgcgcacctggaaagacctggtgcagcgggctcgggtcaagcagctacagccccaa
gagtacaactcgggcaccttcacaatttccaacctgggcatgtttggcgtcgataccttt
gacgcgatcttgccgccgggccagggttcgatcttggcgatcggcgctgcgaagtcccag
gtggtggccacggggaatggcttctcgatccagaagcaaatgcaggtcaatatcacctgc
gatcaccggatcatctatggagcgcacgcagcggctttcctcaaggatctggccgacctg
atcgaaaacaacacccactccctgacgctctag

DBGET integrated database retrieval system