KEGG   Geitlerinema sp. PCC 7407: GEI7407_1183
Entry
GEI7407_1183      CDS       T02366                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00010  Glycolysis / Gluconeogenesis
gei00020  Citrate cycle (TCA cycle)
gei00620  Pyruvate metabolism
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
gei01120  Microbial metabolism in diverse environments
gei01200  Carbon metabolism
Module
gei_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEI7407_1183
   00020 Citrate cycle (TCA cycle)
    GEI7407_1183
   00620 Pyruvate metabolism
    GEI7407_1183
Enzymes [BR:gei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GEI7407_1183
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Other DBs
NCBI-ProteinID: AFY65680
UniProt: K9S690
LinkDB
Position
1413108..1414400
AA seq 430 aa
MIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLATII
VDAGGSAPVGNAIALIAETEAEIEQAQQRASTQSAPAAAPAAPAPSAAAPAAEAPSAASN
GASASPAAREGRLIVSPRARKLAKELKVDLSTLRGSGPHGRIVAEDVEAAAGRPASAPTV
QAASLTAAAPVVASAPAAAAPAPAPVVPGEVTPFNTLQKAVVQGMVASLQVPVFRVSYSI
GTDKLDQLYKQVKSKGVTMSALLAKAVALTLQKHPLLYAAYTDQGTHYNSAINVAVAVAM
DDGGLITPVLQNADQVDLYSLSRTWKDLVQRARVKQLQPQEYNSGTFTISNLGMFGVDTF
DAILPPGQGSILAIGAAKSQVVATGNGFSIQKQMQVNITCDHRIIYGAHAAAFLKDLADL
IENNTHSLTL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgattcacgaagttttcatgcccgctctgagctccacgatgaccgaggggaaaatcgtt
tcctgggtcaaatcgccgggtgacaaggtggaaaaaggtgaaaccgtcgttgtcgtggaa
tccgacaaggccgatatggacgtcgagtccttctacgaaggctacctggccaccatcatc
gtggatgcgggcggctccgcaccggtcggaaacgcgatcgccctgattgctgagaccgaa
gccgaaatcgagcaggcccagcagcgcgccagcacccagagcgcccctgccgctgcaccc
gccgcgcccgccccgtctgctgccgcccctgccgccgaagctcccagcgccgccagcaac
ggcgcctcggctagccccgccgcccgcgaaggccgcctcattgtctcgcctcgcgcccgc
aagcttgccaaagaactgaaagttgacctgtctactctgcgcggcagcggcccccacggc
cgcatcgtcgccgaagacgtcgaagcggccgctggacgtcccgccagcgcgccgaccgtc
caggctgccagccttactgcggctgcgccggtcgtcgccagcgcgcccgctgctgcggct
cccgctccggccccagtggtccccggcgaagtcacccccttcaacaccctccagaaggct
gtggtccagggcatggtggccagcctccaggttcctgttttccgggtcagctacagcatc
ggcaccgacaagctcgaccagctctacaagcaggtgaagtccaagggcgtgacgatgtct
gccctgctggccaaggccgtcgctctgaccctgcaaaagcatcccctgctctacgccgcc
tacacggatcaaggcacgcactacaacagcgccatcaacgtggcggtggcggtggccatg
gacgacggcggcctgatcaccccggtcctgcaaaacgctgaccaggtggatctctactcc
ctctcgcgcacctggaaagacctggtgcagcgggctcgggtcaagcagctacagccccaa
gagtacaactcgggcaccttcacaatttccaacctgggcatgtttggcgtcgataccttt
gacgcgatcttgccgccgggccagggttcgatcttggcgatcggcgctgcgaagtcccag
gtggtggccacggggaatggcttctcgatccagaagcaaatgcaggtcaatatcacctgc
gatcaccggatcatctatggagcgcacgcagcggctttcctcaaggatctggccgacctg
atcgaaaacaacacccactccctgacgctctag

DBGET integrated database retrieval system