KEGG   Geitlerinema sp. PCC 7407: GEI7407_2991Help
Entry
GEI7407_2991      CDS       T02366                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gei  Geitlerinema sp. PCC 7407
Brite
Enzymes [BR:gei01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GEI7407_2991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFY67461
UniProt: K9SBX7
LinkDB All DBs
Position
3686437..3687045
Genome map
AA seq 202 aa AA seqDB search
MSYEFPNLPYAQDALEPHISANTLSFHHGKHHAKYVSTYNEMVQGTENESKSIEEVIKAS
YDPSAKAQSGLFNNAAQSWNHTFYWYCMKPGGGGEPTGELAEKIKADFGSFEKFKEEFKA
AGGSQFGSGWAWLVLDNGTLKVTKTPDAVNPIAQGQTPLLTMDVWEHAYYLDYQNLRPSY
ANTFLDSLVNWDFVAEQYAKAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgaatttcccaacctgccctacgcacaggacgccctcgaaccccacatctcg
gctaacaccctgagcttccaccatggcaagcaccatgccaagtatgtgagcacctacaac
gagatggtgcaagggacagagaacgagagcaagtccatcgaagaagtcatcaaggcttcc
tacgacccgtccgccaaggcccaaagcggtctcttcaacaacgccgctcagtcctggaac
cacaccttctactggtactgcatgaagcccggtggcggcggtgagcccacgggcgagctg
gctgagaagatcaaggctgactttggcagcttcgagaagttcaaggaagagtttaaggct
gcgggcggctctcagttcggcagcggctgggcgtggctggtgctcgacaatggcaccttg
aaagtgaccaagacccccgacgccgtgaaccccatcgcccagggccaaacgcctctgctg
accatggatgtgtgggagcacgcttactacctggactaccagaacctgcgccccagctac
gccaacaccttcctcgacagcttggtgaactgggacttcgtggccgagcagtacgcaaag
gctaagtag

DBGET integrated database retrieval system