KEGG   Geitlerinema sp. PCC 7407: GEI7407_3005Help
Entry
GEI7407_3005      CDS       T02366                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00500  Starch and sucrose metabolism
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GEI7407_3005
Enzymes [BR:gei01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     GEI7407_3005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AFY67475
UniProt: K9SBE7
LinkDB All DBs
Position
3702067..3704676
Genome map
AA seq 869 aa AA seqDB search
MQPIRTFNVAPSLPSRLEPLRKLAYNLHWDWNTETRELFDRLDRDLWESSNHNPVLMLGT
ISQERLREVAEDAGFLAQMDRAAQQLNDYVQEQSWYRKHRGANLETRSSSKSHGKECYAY
FSAEFGLTTCMPIYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQEGYFAQYLNPDGWQQE
RYPINDFYNMPLILERNADGSEMRIEVDYPGRKVYARVWRLQVGTVPLYLLDTNIEPNNP
YDHDITDELYGGDIDMRIHQEMMLGIGGFQMLKALGLNPTVYHMNEGHSAFVSLERMRHL
IQDENLGFAEARQVVKASQMFTTHTPVPAGFDLFPPDKVMHYVGRYAEVFGLSREQFLAL
GRDNTGDLASAFSMATLAIKTATFVNGVSQLHGAVSRSLFQPLWSDLPLDEVPITAITNG
VHARSCVAKSTQELYDRYLGPNWASAPGDDPLWERVYSIPDEELWRNHERCRSALVVFVR
DRLQKSLREQGASPTAIADALDVLDPSALTIGFARRFATYKRATLFMRDVERIKRILAGV
RESGHRRPVQFVIAGKAHPKDIPGKEMIKEIIHFIRDEGVQHNIVFIPNYDIRVSRLMVA
GCDVWLNTPRRPREASGTSGMKAAMNGLLNLSVLDGWWDEADYVRTGWPIGYREVYSDPA
YQDEVEANALYELLEKEVVPLFYERDAEDVPRRWTAKMKDAIRLNCPRFNTARMVRDYAT
QGYFPTSDRYWTLTSQEYAPAKELAQWQNNLLDHWYDMRIEDIDISADADVEVNQAIAVK
ARINLAALTPDDVQVELYQGPVNEGGEIFAGVPLVMDCQGKDANQHTIYTATVTYGSSGL
QGLSLRVLPKHRYLSSVYEPRQILWAAPH
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgcacattcaacgttgccccttcccttccctcgcgcctcgaaccgctg
cgtaagctcgcctacaatctccactgggattggaataccgagacacgcgaactgttcgac
cgcctagaccgggacctttgggaatccagcaaccataaccccgttctcatgctcggcacc
atcagccaagagcgcctgcgcgaagtcgcagaagacgcaggcttcttggcccagatggac
cgcgccgcccagcagctcaatgattatgtccaagagcaaagctggtatcgcaaacatcgc
ggcgccaacctcgagacccgcagcagcagcaaaagccatggcaaggagtgctacgcctac
ttctccgccgaatttggtttgaccacctgcatgcccatttactcgggcggcctgggcgtt
ttggccggtgaccacctcaaatccgccagcgacctcggactgcccttggtgggcgtcggc
ctcctctaccaagaaggctactttgcccagtacctcaaccccgacggctggcagcaagag
cgctaccccatcaatgacttctacaacatgccattgatcctggagcgcaacgccgatggc
tccgaaatgcgcatcgaagtcgactacccaggccgcaaagtctatgcccgggtgtggcgc
ttgcaggtggggacggtgccgctgtatctcctcgacaccaacatcgagcccaacaatccc
tacgaccacgacatcaccgacgagctctatggcggtgatatcgacatgcggatccaccag
gagatgatgctgggcattggaggcttccagatgctgaaggcgctggggctcaatccgacg
gtgtaccacatgaacgaggggcactccgcctttgtgtccctcgagcggatgcgccacctg
atccaggacgaaaatctgggcttcgcggaagctcggcaggtggtgaaggcgagccaaatg
tttacgactcacacgccggtgcctgcgggcttcgacctgttcccgccggacaaggtgatg
cactatgtgggtcgctatgcggaggtgtttggcctgtctcgggagcagttcctcgccctg
ggccgggacaataccggtgatttggcgtcggcgtttagcatggcgacgctggcgatcaag
acggccacgttcgtcaatggggtcagccagctccacggcgcggtctcgcggagtcttttt
cagccgctgtggtctgatttgcccctcgatgaggtgccgatcacggcgattaccaatggg
gtccatgcgcgcagctgcgttgcgaagtcgacgcaggagctgtacgaccgctatctgggc
cccaattgggcgagcgcgccgggagatgatccgctgtgggagcgggtgtactcgattccg
gatgaggagctgtggcgcaaccatgagcgctgccgatcggcgctggtggtgtttgtgcgc
gatcgcctgcaaaagagcctgcgagagcagggcgcttcgccaacggccattgcggatgcc
cttgatgtgctcgatccttcagcgctgaccattggctttgcgcggcgctttgcgacctac
aagcgagccacgctgtttatgcgggatgtggagcgcatcaagaggattttggcgggggtg
cgcgaaagcggccatcgccgacctgtgcagttcgtgatcgccgggaaagcgcaccccaaa
gacattccgggcaaagaaatgatcaaagagatcattcactttattcgcgatgaaggggtc
cagcacaacattgtgtttatccccaactacgatattcgggtttcgcgcctgatggtggcg
ggctgtgatgtctggctcaacacgcctcgccgcccccgcgaagcgtcgggcaccagcggc
atgaaggcggcgatgaatggcctgctcaatctcagcgtgctggacggctggtgggatgaa
gcggactatgtgcgcacgggctggccgattggctaccgggaggtctacagcgatccggcc
taccaggatgaggtggaggccaatgcgctctacgagctgctagagaaggaagtggtgccg
ctgttttatgagcgggatgcggaggatgtgccgcggcgctggacggccaagatgaaggac
gcgattcggctcaactgccctcgctttaacacggcgcggatggtgcgcgactacgcaacc
cagggatatttcccgacgagcgatcgctactggacgctgacgagccaggaatatgccccg
gccaaggagctggcccaatggcaaaacaacttgctcgatcactggtacgacatgcggatc
gaggacattgatatttcggcggatgcggatgtcgaggtcaatcaggcgatcgccgtcaaa
gcgcggatcaacctggcggccctgactcccgacgatgtccaggtcgagctatatcaaggc
ccggtcaacgaaggcggcgaaatcttcgccggggtgccgctggtgatggactgccaagga
aaagatgccaaccagcacaccatctacaccgccacggtcacctacggcagcagcggcctc
caggggctgtctctacgcgtcctgcccaagcaccgctacctcagcagtgtctacgaaccc
cggcagatcctctgggccgcgccccactag

DBGET integrated database retrieval system