KEGG   Geitlerinema sp. PCC 7407: GEI7407_3448Help
Entry
GEI7407_3448      CDS       T02366                                 

Definition
(GenBank) Glutathione S-transferase domain protein
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C GST_C_5
Motif
Other DBs
NCBI-ProteinID: AFY67915
UniProt: K9SCN8
LinkDB All DBs
Position
complement(4208016..4208708)
Genome map
AA seq 230 aa AA seqDB search
MAKVEIYSAQVCPFAQRSRLTLLEKGVDFEVIEIDLNHKPDWFQSVSPYLKVPVVKVGDD
RVWESSIINEYLEEVFPDPPLMPPTPVQRAIARIWIDFANNQFIPAFYKLLMAQEGDRQR
EWATQLSAHLRFLEYEGLRKTSEGPFWLGDRVSLVDLTYAPWFERWSALSHYRGIKIPAE
YTRLHQWWQAMQARPSMQATQQPAEYHIAAYEKYANDTATGITAQELRRT
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggtcgagatttacagcgctcaggtgtgtccctttgcccagcgatcgcgcctg
acgctgctggaaaagggggtggactttgaggtgatcgaaattgacctcaaccacaagccg
gactggtttcagtcggtgtcgccctacctcaaggtgccggtggtcaaggtgggcgacgat
cgcgtgtgggagtcctccatcatcaacgagtacctggaggaagtgtttcccgatccgccc
ctgatgcccccgacgccggtccagcgggcgatcgcccgcatctggattgactttgccaat
aaccagttcattccggctttttacaagctgctcatggcccaagagggcgatcgccagcga
gagtgggcgacgcagctgtcggcgcacctgcgctttttggagtacgagggtctgcgaaaa
acctcggaagggccgttttggctgggcgatcgcgtaagcctggtcgacctcacctacgcg
ccgtggttcgagcgctggtctgccctgagccactaccggggcataaaaattccggcggag
tacacgcggctgcaccagtggtggcaggcgatgcaggcccgcccctcgatgcaggctacc
cagcagcccgccgagtatcacattgccgcctacgagaagtacgccaacgacaccgccacg
ggcatcacggcccaggagctgcggcggacctga

DBGET integrated database retrieval system