KEGG   Geitlerinema sp. PCC 7407: GEI7407_3556Help
Entry
GEI7407_3556      CDS       T02366                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Kinase-like DUF5337 RIO1 Peripla_BP_3 Choline_kinase
Motif
Other DBs
NCBI-ProteinID: AFY68023
UniProt: K9SCU4
LinkDB All DBs
Position
4328733..4330205
Genome map
AA seq 490 aa AA seqDB search
MNSLVGQTLQNGKYTLQEEIGRGGFGVTYKATHHYLGQWVVIKTLNEGMHNHPDFQASEQ
KFQDEARRLAACSHPNIVRVSDFFIEGGLPYMVMDYIPGPTLDKLVFPNNPLPEALAVHY
SRQIGAALQAVHQNGLLHRDVKPQNVILREGTQDVVLIDFGIAREFSPNVTQVHTSMVSA
GYAPIEQYLTKAKYTPASDVYGLAATLYALVTAQVPVASILRDRQPLAMPRSINPQLSPA
LEQAILRGMAMEVDQRPPTMDAWLALLPATGVAAGAMKGETRTQTAATVPVMPRRPAPPR
SPAATRAAAPKPRTAAPPRRSPSPAAPRRTGDPASFPMALFGLIALAVIIGSAIAAFQIQ
RDRPSAPSPSPAPETPSSEPSPSIAPPIDLAPPEPSESPSPEPSVPPEPSPPSPEPSESP
SPSPEPTASPSPEPTVSPSPEPVEESPAPEPSPEPPVEPVPPEPEPVPPEVVNPEPVEPA
PPPAEPQPPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaactctttggtcggtcaaaccctgcaaaacggcaagtacacgctccaggaagaaatc
gggcgtggtggctttggcgtgacgtacaaggcaacccaccattatttgggtcagtgggtg
gtgatcaaaaccctcaatgaagggatgcacaaccaccctgattttcaggcgtcagaacaa
aagtttcaggacgaggcgcgacgcctagcggcctgtagccatcccaatatcgtgcgggtg
agcgacttctttatcgaaggcggcctgccctacatggtgatggactatattccaggcccc
accctcgacaagctggtttttcccaataatccgctgcccgaggcgctggcagtccactac
agccgccagatcggggcggcgctccaggccgttcaccaaaatggcttgctccatcgggat
gtgaagccgcaaaacgtgattttgcgggagggcactcaggatgtggtgctgattgacttt
ggcatcgcgcgggagttttcgcccaatgtgacccaggtgcacacgagcatggtgtcggcg
ggctatgcgcccatcgagcagtatctgacgaaggcgaagtatacgcctgccagtgatgtg
tatgggctggcggcgacgctgtatgcgctggtgacggcccaagtgccagtggcgtcgatc
ctgcgcgatcgccagcccctggcaatgccccgcagcatcaatccccagctgagcccggcc
ctggagcaggcgatcttgcggggaatggcgatggaggtagaccagcgcccgcccacgatg
gatgcgtggctggcgctgctgccagcgaccggcgtggcagcgggcgcgatgaaaggggaa
acccgcactcagacggcggccacggtgccggtgatgccgcgccggccagcgccgccgcga
tcgcccgcagcgacccgcgccgccgcaccgaagcctcgcacggctgcgccgccccggcga
tcgccctcgcctgccgcgccgcgccgcacgggcgatccggcgtcgtttcccatggcgctg
tttggcctgattgccctggcggtgatcattggatcggcgatcgccgcgttccagattcag
cgcgatcgcccctcagcaccctcgccctcacccgcccccgagactcccagcagcgagccc
agcccgtcgatcgcgccgccgatcgatttggcgccgcccgagcccagcgagtctccaagc
cctgagcccagcgtaccgcccgagccctcacccccttcgccggaacccagcgagtctcct
tcaccgagtcccgaaccaaccgcctcccccagtccagagcccacggtttcgccgtccccc
gagcccgtcgaggaaagtcctgcgcccgagcccagccccgaaccgcccgtcgagccagtg
ccgcccgagcccgaaccagtgccccctgaggtagtcaatcccgaaccggtagagccagca
cctcctcccgctgagccccagccgccggtctag

DBGET integrated database retrieval system