KEGG   Geitlerinema sp. PCC 7407: GEI7407_3639Help
Entry
GEI7407_3639      CDS       T02366                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00970  Aminoacyl-tRNA biosynthesis
gei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GEI7407_3639
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gei03029]
    GEI7407_3639
Enzymes [BR:gei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GEI7407_3639
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GEI7407_3639
Mitochondrial biogenesis [BR:gei03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GEI7407_3639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFY68106
UniProt: K9SDN9
LinkDB All DBs
Position
4436134..4437621
Genome map
AA seq 495 aa AA seqDB search
MTTAAPVKTQYEAIIGLETHCQLRTNTKIFCNCSTTFGAPPNTNVCPVCLGMPGVLPVLN
QTVLEYGVKAGLALNCAIAPFSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWLEIELTDG
EGNPVRKKIGITRLHMEEDAGKLVHGGSDRLSGSTHSLVDYNRAGVPLLEIVSEPDIRSG
QEAAEYAQELRRTMRYLGVSDGNMQEGSLRCDVNISIRPVGQEAFGTKVEIKNMNSFNAI
QRAIEYEIERQIAAVEAGEPILQETRLWEEGSQRTISMRIKEGSSDYRYFPEPDLTPIEV
SPAQLEHWRSELPELPAQKRHRYESELGLSAYDTRVLTDDPDVAAYFEGAVIAGSPIKQT
ANWVMGDIAAYLNSKPGLSIRAIALTPAVLAEMVSLIEDGTISGKIAKEILPDLLEKGGS
VKALIEEKGLVQISDPAALGAIIDEVLAENPTELEQYRNGKTKLQGFFVGQVMKKTSGRA
DPKLTNQLLGPKLKG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgctgcgcccgtaaaaactcagtacgaagcgatcatcgggttagaaacccac
tgtcaacttcgcaccaacaccaagattttctgtaactgctccaccaccttcggcgcaccc
cccaacaccaacgtatgcccggtctgcttggggatgccaggggtgctgcccgtgctcaac
caaaccgtgctggagtacggcgtgaaagcgggtctggccctcaactgcgcgatcgcacct
ttcagcaaattcgatcgcaagcagtacttctatcccgacctgcccaaaaactaccagatt
tctcagtacgacctgcccatcgctgagcacggctggctcgaaatcgagctgaccgacggc
gaaggcaaccccgtacgcaagaaaatcggcatcacccgcctgcacatggaagaagacgca
ggcaagctggtccacggcggcagcgatcgcctctccggctccacccactccctcgtggac
tacaaccgcgccggcgtccccctgctcgaaatcgtctccgagcccgacattcgctccggc
caagaagccgccgagtacgcccaagagctgcgccgcaccatgcgctacctcggcgtcagc
gacggcaacatgcaagaaggctccctgcgctgcgacgtcaacatttcgatccgtcccgtc
ggccaagaagccttcggcaccaaggtcgaaatcaaaaatatgaactccttcaacgccatc
cagcgggcgatcgagtacgaaatcgagcgtcaaatcgccgccgttgaagcaggcgagccc
atcctccaggagacgcgcctgtgggaagaaggcagccagcgcaccatcagcatgcggatc
aaagaaggctccagcgactaccgctacttccccgagcccgacctcacccccatcgaggtg
tcccccgcccagctagagcactggcgctccgagctgcccgagctgcctgcccaaaagcgc
catcgctacgagtccgagctgggtctgtcggcctacgacacccgcgtcctgaccgacgat
cctgacgtggccgcctactttgagggggccgtcatcgccggtagccccatcaagcagacc
gccaactgggtgatgggcgacattgccgcctacctcaacagcaagcccggtctctccatc
cgcgcgatcgccctcacccccgccgtcctcgccgaaatggtcagcctgatcgaagacggc
accatcagcggcaagatcgccaaggaaatcctgccggatctcctggaaaaaggcggctcc
gtcaaggccctgatcgaggaaaagggcctggtgcagatttctgacccggcagccctcggg
gccatcatcgacgaagtcctcgccgagaaccccaccgagctggagcagtaccgcaacggc
aaaaccaagctgcaaggcttctttgtcggtcaggtaatgaagaaaaccagcggccgagca
gacccgaagctcaccaaccagctcctcggtcccaagctcaagggctag

DBGET integrated database retrieval system