KEGG   Geitlerinema sp. PCC 7407: GEI7407_3808Help
Entry
GEI7407_3808      CDS       T02366                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00630  Glyoxylate and dicarboxylate metabolism
gei00710  Carbon fixation in photosynthetic organisms
gei01100  Metabolic pathways
gei01120  Microbial metabolism in diverse environments
gei01200  Carbon metabolism
Module
gei_M00165  Reductive pentose phosphate cycle (Calvin cycle)
gei_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
gei_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GEI7407_3808
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    GEI7407_3808
Enzymes [BR:gei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     GEI7407_3808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFY68275
UniProt: K9SDQ7
LinkDB All DBs
Position
complement(4629862..4630203)
Genome map
AA seq 113 aa AA seqDB search
MQTLKKERRFETLSYLPPLSDAQIARQVQYILDQGYFAAVEFNETSNPTEVYWTMWKLPL
FSANSVQEVLNEVQQCRSEYPNCYIRVIGFDNIKQCQTLSFIVHKPNSGGYRY
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacactaaagaaagagcgtcgcttcgaaaccctttcctatctgccccctctgtcg
gatgcgcagatcgctcgtcaggtccagtacatcttggatcagggctacttcgcggcggtt
gagttcaacgaaacctctaaccccaccgaagtgtactggacgatgtggaagctgcctctg
ttcagcgccaacagcgttcaagaggtcctgaacgaagtgcaacagtgccgttctgagtac
cccaactgctacatccgcgtgatcggcttcgacaacatcaagcagtgccaaacgctcagc
ttcatcgttcacaagcccaacagcggcggctaccgctactaa

DBGET integrated database retrieval system