KEGG   Geobacillus sp. JS12: A0V43_00755Help
Entry
A0V43_00755       CDS       T04412                                 

Definition
(GenBank) competence protein ComK
  KO
K02250  competence protein ComK
Organism
gej  Geobacillus sp. JS12
Pathway
gej02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gej00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A0V43_00755
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gej03000]
    A0V43_00755
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gej02044]
    A0V43_00755
Transcription factors [BR:gej03000]
 Prokaryotic Type
  Other transcription factors
   Others
    A0V43_00755
Secretion system [BR:gej02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   A0V43_00755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: AMQ19748
UniProt: A0A142CY96
LinkDB All DBs
Position
128309..128842
Genome map
AA seq 177 aa AA seqDB search
MKVNEFIVLEQFIVSRYTMAILPYFLNSDVYAKVIEEDGEYIIKQTPMDIIKHSCDYYGS
SFQGRKEGTKAVIGITHKAPIAIEPANEIYVFPTASPRDSRCVWLSHMHVYRYEPAKYER
TIVYFRNGKSISLDVSCKSFINQLYRTAQLRTKLSERMEARERKLQYIFRMQQEKQS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcaatgaattcattgtcttggagcaattcatcgtaagccgttatacgatggca
attctcccatactttttaaacagcgatgtgtatgcgaaagtcattgaggaggacggtgaa
tatatcatcaaacaaacgccgatggacattattaaacatagttgcgattactatggaagc
agctttcaagggagaaaagaaggaacaaaagccgtcattggcatcacccataaagcgccg
atcgccattgaaccagccaatgaaatttacgtatttccaaccgcctctccgcgtgactcc
cgctgcgtttggctctcgcacatgcacgtttatcggtatgagcctgccaaatatgagcgg
accatcgtttatttccgcaacggaaaaagcatatccctcgatgtttcctgcaaatcgttc
atcaaccagttataccgaacggctcaactgcggacaaaattatccgagcggatggaagcg
agggagcgcaaactccaatacatatttcgcatgcagcaagaaaaacagagttag

DBGET integrated database retrieval system